spacer

EBI Dbfetch

ID   AF030199; SV 1; linear; genomic DNA; STD; MUS; 6973 BP.
XX
AC   AF030199;
XX
DT   26-JAN-1998 (Rel. 54, Created)
DT   14-NOV-2006 (Rel. 89, Last updated, Version 2)
XX
DE   Mus musculus type 1 sigma receptor gene, complete cds.
XX
KW   .
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi; Muroidea;
OC   Muridae; Murinae; Mus; Mus.
XX
RN   [1]
RP   1-6973
RX   DOI; 10.1006/bbrc.1997.7840.
RX   PUBMED; 9425306.
RA   Seth P., Leibach F.H., Ganapathy V.;
RT   "Cloning and structural analysis of the cDNA and the gene encoding the
RT   murine type 1 sigma receptor";
RL   Biochem. Biophys. Res. Commun. 241(2):535-540(1997).
XX
RN   [2]
RP   1-6973
RA   Seth P., Leibach F.H., Ganapathy V.;
RT   ;
RL   Submitted (15-OCT-1997) to the INSDC.
RL   Biochemistry, Molecular Biology, 15th Street, Augusta, GA 30912-2100, USA
XX
DR   MD5; ca14f75fd9f0f758e5fdd5a6841889ec.
DR   Ensembl-Gn; ENSMUSG00000036078; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000059354; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000071561; mus_musculus.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..6973
FT                   /organism="Mus musculus"
FT                   /strain="129SV"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:10090"
FT   mRNA            join(3269..3496,3622..3822,3956..4048,5018..6089)
FT                   /product="type 1 sigma receptor"
FT   exon            3269..3496
FT                   /number=1
FT   CDS             join(3346..3496,3622..3822,3956..4048,5018..5244)
FT                   /codon_start=1
FT                   /product="type 1 sigma receptor"
FT                   /note="mSigmaR1"
FT                   /db_xref="GOA:O55242"
FT                   /db_xref="InterPro:IPR006716"
FT                   /db_xref="InterPro:IPR028545"
FT                   /db_xref="MGI:MGI:1195268"
FT                   /db_xref="UniProtKB/Swiss-Prot:O55242"
FT                   /protein_id="AAB97683.1"
FT                   /translation="MPWAAGRRWAWITLILTIIAVLIQAAWLWLGTQNFVFSREEIAQL
FT                   ARQYAGLDHELAFSRLIVELRRLHPGHVLPDEELQWVFVNAGGWMGAMCILHASLSEYV
FT                   LLFGTALGSHGHSGRYWAEISDTIISGTFHQWKEGTTKSEVFYPGETVVHGPGEATALE
FT                   WGPNTWMVEYGRGVIPSTLFFALADTFFSTQDYLTLFYTLRAYARGLRLELTTYLFGQD
FT                   S"
FT   exon            3622..3822
FT                   /number=2
FT   exon            3956..4048
FT                   /number=3
FT   exon            5018..6089
FT                   /number=4
XX
SQ   Sequence 6973 BP; 1753 A; 1675 C; 1648 G; 1896 T; 1 other;
     ctgggtattg tttgcttaca gcaactaaga ttacataccc taagtcatat agactggagc        60
     catgttactg tctatcacac agctagtggt taaggctgag aggacgggat tatttattta       120
     tgaggaactg tatttatgat ggaatgtgaa agggcaatga actagagagg tctcagtggt       180
     cttagaaaat tgtcaactta gggataacat agaagccagc agctgtttca aaacacgttt       240
     cctcaacctt tcatcctcaa ctagattact caaaactaac aaatacacaa cagttcacct       300
     ccccagcctc tggtctctgt agcacaatat attgcaacat gggcaagtga aaggcaacag       360
     agcaaagact tattagaatg gcttaaaggc ccagatagtc caacaatggc tgcctaccaa       420
     tggaaggtcc aagaattcag tttttcagtc caatgaggct gatatctcag cttgtcttca       480
     gtatatgctg gaatcccaaa gaagtaagct ctaatgccat gagaaggaat ggacttgcca       540
     tcaagagcaa aggcaggtct gcaaagagga ggcacatctc ctacttctgt gtcccttata       600
     taggctgcca gcagaaggta tggtccaaaa ttaataatgt atcttcctat ctcaacgatc       660
     tggctcagaa gtaagtcttc ccacatcaga tggggttttt ttggttgttg ttgttggttt       720
     ttttgttttg ttttgttttt tgttttgttt tgagacaggg cttctctgta tagccctggc       780
     tgtcttggaa ctcactttgt agaccaggct ggccttgaac tcagaaatcc gcctgcctct       840
     gcctcccgag tgctgggatt aaaggcatgc accaccacgc ccggctcaca tcaaatgatt       900
     taattaaaga acaaaataaa ccctcacagg tgttttttga gtttcagatg tagtcaagtt       960
     gatgaccaag aagaaccact atattatact tgtagtatta aaatccatcc tgcaagaatt      1020
     cctttagcag gatggaaacc aactcaaaac agcttcagga agtccctgaa actgaccaaa      1080
     tttactagac tcctccctgc tatagtaagc aataaatgct gagagtccca tttagacaaa      1140
     gtgaagccaa gctgcaaaaa agtatcttga gaccagacta gtcctgaaga aacagactag      1200
     tcaagctgct tgggagaggt ttagactaga gtctcttgaa aaggacacta caacctgtag      1260
     agccttcagg ctgcttccag gttttgtgag ctgtcaccca tgctgggctg ggctttggtg      1320
     atgcagctgt ctttgactct gatttctgtt cctgcaagta actcctcacc cacagtccag      1380
     caagtaaccc caataaaact cattagttca ccaaattgga ttttggtggt atctgtactt      1440
     tcaattgtca taggctccct atctgaagtg tgttgtgttt cctcaggaaa cattttgtca      1500
     cacaacaata agtcttctga aattgggcaa aggtgaaaaa gagagaggac agaatttctt      1560
     ttttttttaa atatatgtat tggtgttttg cctgcatgta tgccagtata tcatgtgggt      1620
     acaattccca cagaggctag aaggagtcaa atctactgga actgagctac aaacagttgt      1680
     gagccaccat atgcatgcta tgaatcaaat caagatcctc tggaaaagca gaagagcagc      1740
     tagtgctgtt aaccacggag gcatctctcc agcctcaaga tttcacatat ttttagaaac      1800
     tagacctgaa aatgtcttac agcatttctg tttccatttt attatctgga ataaaaccac      1860
     ctgggtacat ggccccatat acagagatta tagaatgtat tttggtcgct caagagcaaa      1920
     aggaaagccg ggcatggtgg cgcacacctt taatcccagc actcagaagg cagaagcagg      1980
     cagatttctg agttcaaggc cagcctggtc tacaaagtga gttccaggac agccagggct      2040
     atacagaaga aaccctgtct caaaacaaaa caaaacaaaa caaaacaacc aaaaaaaaaa      2100
     gcaaaaagaa atgtctctgc cacataaaaa tgccatgaaa agccattccc catgtttcgt      2160
     gaacccctcc cttatatttg cctgatggat ttcattccat cagttctttg tgttctagct      2220
     cctttatggg tttggctgtt gttcttgttg ttgctttaga catggtttcc tgaggcctct      2280
     gctgactttt gctatggtga ccttgaactg atcttggtgc cttcccacgt tctagaatta      2340
     caagcaatac atgtcttaca ttgtcttttt ctaactaaca tgtataatcc taaccatgtg      2400
     ccaggcacta attactttaa aaaattaatt catttaatgt taatcataat gaaggtatgg      2460
     gctacgaagc agatactttt taatttagtc tatgttacag ataaagctat caatgcatac      2520
     tcttaaatgc tgacacatat gggctctctg tcttagatct tagtccaatt ttgctcccct      2580
     cctctattta gcccagaatc attctgtgtc aacatcgaat cccatagctc cccagtggac      2640
     aaatctattg gttttcaagg tctttcacac ttttgtgctt cagaacatag aatgaatcat      2700
     aggatcggag aaaacactaa gctaaacatg catggtggtg cgcgcccctg atcccagtat      2760
     tggagaggca tcgatcgagg ctatcctagt ctataggcta gctaaagttg tctaaaatat      2820
     tacaaatata tgtacacata catatataca taaatgcatg tatgctgtct cacactcctc      2880
     tgctctttga ctcctggaat agttcccatt gactctctct ctctctcatg gacacttcag      2940
     atatcaccgc ttctttccta aggttcccag tggcactatc ttcaacctgc ttctgtgcta      3000
     gcagacctag aaagctctac ttctgggctc gctagctcag gtgggccagt ccattctggg      3060
     tctccccgct tggggacacc aagattgaac ccaacagggt ggcagccagg aggcgaggcc      3120
     ccgcctctca cctctcttgc agaccaagcc actaaaccta cgctctcccc tctagaaaat      3180
     ggttcaatcc agaggcggtg ctaggtgacc cggacgttcc gattggcccc ggcgagccgt      3240
     accacggtgg cgggggcgac cgtaggcagc ggcttttgag tcgtgaaccc acagcctgtg      3300
     gccctagttc ggtcttacgt tggtggtgcc aggctgcccg ctagaatgcc gtgggccgcg      3360
     ggacggcggt gggcatggat caccctgatt ctgactatta tcgcagtgct gatccaggcc      3420
     gcctggttgt ggctgggcac tcaaaacttc gtcttctcta gagaagaaat agcgcagctt      3480
     gctcgacagt atgcgggtga gccggtgagg gcggagagtg gggtggccga cacggagcgg      3540
     agccgcgctt tccgagggct ggtcctcgcc aagcttcaga ccgcgggctg gtctcacccg      3600
     cgcttctcct ttttgcacca gggctggacc atgagcttgc cttctctcgg ctgatcgtgg      3660
     agctgcggag gctgcaccca ggccacgtgc tgccggatga ggagctgcag tgggtatttg      3720
     tgaacgcggg cggctggatg ggcgccatgt gtattctgca cgcctcgctg tctgagtacg      3780
     tgctgctctt cggcaccgcc ctgggctccc atggccattc gggtcagtgt tggcggtggg      3840
     tcggattggg aggctgggac tgttcgaggg ccggtgccct ccattccaag gtttggctgg      3900
     gccgtgtatt gacaaggatt ccctgatggt cggtgtctat tttactgtca atcaggacga      3960
     tactgggctg agatttctga caccatcatc tctggcacct tccaccaatg gaaagagggc      4020
     accacgaaaa gtgaggtctt ctacccaggt gcgtaaggaa gttctgtccg agggggcgcc      4080
     ctctagatag ggacgggcat aagacttgga aagggcgtgt ttaagaaggc ctaccagtga      4140
     tttccttcct tccctccctg gtaagccaca ggtgtttcgt tagggtcgag ctaggaaccc      4200
     tgatgctttc gactgttaag ggaaacagaa cacggcagtt tccaagtcat agagaacttg      4260
     atttttttta tcagcctgtt taacccagca attatctggg ttatacccaa aagttaagac      4320
     aggcatttgt ttccttaaac tagagtggca gtttggggtt tttgtatttt tgttattgtt      4380
     tgtttttatg cgtctgggtt ttgcttacac acaccaaccc cttaactgcc tggtgcctta      4440
     aaggccagaa gagggcatct gatcccagag actgaagtta tagactgttg tgagccttca      4500
     tgtgggtgct gggaagtgaa cctgggtcct ctggagtagg agccagggca cagctgagcc      4560
     atctggctag caaactcctg gtggtgtttt tttaatgtac ctctgaatct gtttaaaaga      4620
     aaaaaaggcg tgggcttgct ggtgtaaggt taagcatcac actttgtgac tgaacaggcg      4680
     catttctcag agagcctggc aagccctgta accacacaga atttccacca gatatgattg      4740
     cagcttggaa atgcagatgc cataattcta tacgttagcc tgtagctggg ttggggtggc      4800
     cttccaaggg ccaggtgatg ccattggtat aagtgttttg gtctttgtcc tctgatcaag      4860
     cagcttggca tagggtagaa gaactttttc ttttcttgaa actgtctttt cattcccctc      4920
     ctctccatag atagcccata ggctagacaa atgcagtatg gaaggccagg gcagagctgg      4980
     gctcctcatg aggtttctta tcctgtctgt ctcccaggag agacagttgt acacgggcct      5040
     ggagaagcaa cggctctgga gtggggacca aacacgtgga tggtggagta cggccggggt      5100
     gttattccgt ctaccctgtt ctttgcacta gccgacactt tcttcagcac ccaggactac      5160
     ctcacactct tctataccct tcgggcctat gcccggggcc tccggcttga gcttaccacc      5220
     tacctctttg gccaagactc ctgaccagcc aggcctgaag gaagatctgt ggatggacag      5280
     gagcgcggca ggaccacatc catctctcta ctcgctggaa ctcatattca gacagcagcg      5340
     tataccatgc agatattaag tacctgctgt atgaggaagg acatacatac ttgtacatcc      5400
     agacacagct cttgggaagc aaatgagaca cagagatgct aagacttgta tgtactgtaa      5460
     gatcatgcac tcacatccac ccagaaaggg tcctctacat atactccagg gggccagtca      5520
     tgtttgaaca cacatcacaa gcttgactca ctgactcagg ctttcctaga gcctcctgct      5580
     ggcattcagg gctctgggat caagggttga ggtagatgtt acacactacc tcactctgat      5640
     gcctcattcc tgtagtaatc tctggtgaag ggaaagagga gctgcccttc ggaggtcccc      5700
     ttcacctgca gctatgatgc ccttcccttc atccctttcc tcaccatatg ccttatctcc      5760
     attccactcc cctgctatgc aaatgccccc ctggcttgtc ctccctgccc ccccccggca      5820
     accagttcag ctgggaaagc agaggnatgt agaggatgct aaagggaagg gaggtcctcc      5880
     actacggaga cccttgttgg ggttagattg gaaaagctgg ctagtgcccc agggcccagt      5940
     tcccaaggag aggacctgga gaagtaagcc ggggtccaag gagccacccc attccaaaag      6000
     aagcctttag tgtgtgtgtg cacaccctat cagtttccag acatatctgt tgcaatctct      6060
     gtcttcttgt ctctctctgt taataaaaac atattaaaca gtttcgtttc cttatgtgtc      6120
     taaacagcag ggaagccagc tgcctcctgg ggcactaaaa ggcctcctgt acaatccagt      6180
     ttgtaagaca aggtttagac agaagggagt gtgctaagaa ttactttgaa gtcagccttc      6240
     taggggtggt ggtgttaaac ctttggctct agactcagct ctgcctgctg ttggcatctg      6300
     agtgttggaa ctggaagtga gcaccaccac acccagagtg ccccccccca ccccccgcaa      6360
     tataaagctg acttagaatt tacgatgtga tactgaaatt caccgtgaac ttaacctcca      6420
     gcttccactt cctaggactg agaattaagg ccaaggcttt gtgcagtctg ggcaagcgct      6480
     gtgctaacca cacccttaga agacagatga gtcactgagg ctggctggct tgcatctata      6540
     gagataaatt ttttttttaa ttttatttct ttttttatat gagtacactg cagctgtctt      6600
     cagacacaca ctagaagggt gctttggatt ccatgacaga tggttgtgag ctaccatgtg      6660
     gttgctggga tttgaactca ggatctctga cagagcagtc agtgttctta tctgctgagc      6720
     cgtctctcca gcccctcgag ataagttttt gaatatgaaa aaatgagacc cgtgtgtcta      6780
     ctttgctagt ctgtcctaga ggtggtcctg agaacttcac tgcacatggc catggggtgg      6840
     cactgtgctc ccacatttga gctgaaacag acctcagctg gttcttccgg gctgacagaa      6900
     tagagtacac cactaactgg aacaagagtt cctctgctct ggtttgcctt tgacccagca      6960
     cttattgcga gct                                                         6973
//


spacer
spacer