spacer

EBI Dbfetch

ID   AF030198; SV 1; linear; mRNA; STD; MUS; 1567 BP.
XX
AC   AF030198;
XX
DT   26-JAN-1998 (Rel. 54, Created)
DT   23-SEP-2008 (Rel. 97, Last updated, Version 2)
XX
DE   Mus musculus type 1 sigma receptor mRNA, complete cds.
XX
KW   .
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi; Muroidea;
OC   Muridae; Murinae; Mus; Mus.
XX
RN   [1]
RP   1-1567
RX   DOI; 10.1006/bbrc.1997.7840.
RX   PUBMED; 9425306.
RA   Seth P., Leibach F.H., Ganapathy V.;
RT   "Cloning and structural analysis of the cDNA and the gene encoding the
RT   murine type 1 sigma receptor";
RL   Biochem. Biophys. Res. Commun. 241(2):535-540(1997).
XX
RN   [2]
RP   1-1567
RA   Seth P., Leibach F.H., Ganapathy V.;
RT   ;
RL   Submitted (15-OCT-1997) to the INSDC.
RL   Biochemistry and Molecular Biology, Medical College of Georgia, 15th
RL   street, Augusta, GA 30912, USA
XX
DR   MD5; 0ddc448a552abbe69480271200020232.
DR   Ensembl-Gn; ENSMUSG00000036078; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000059354; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000071561; mus_musculus.
DR   EuropePMC; PMC14614; 11149946.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1567
FT                   /organism="Mus musculus"
FT                   /strain="C57BL/6 "
FT                   /mol_type="mRNA"
FT                   /tissue_type="kidney"
FT                   /db_xref="taxon:10090"
FT   CDS             22..693
FT                   /codon_start=1
FT                   /product="type 1 sigma receptor"
FT                   /note="mSigmaR1"
FT                   /db_xref="GOA:O55242"
FT                   /db_xref="InterPro:IPR006716"
FT                   /db_xref="MGI:MGI:1195268"
FT                   /db_xref="UniProtKB/Swiss-Prot:O55242"
FT                   /protein_id="AAC39951.1"
FT                   /translation="MPWAAGRRWAWITLILTIIAVLIQAAWLWLGTQNFVFSREEIAQL
FT                   ARQYAGLDHELAFSRLIVELRRLHPGHVLPDEELQWVFVNAGGWMGAMCILHASLSEYV
FT                   LLFGTALGSHGHSGRYWAEISDTIISGTFHQWKEGTTKSEVFYPGETVVHGPGEATALE
FT                   WGPNTWMVEYGRGVIPSTLFFALADTFFSTQDYLTLFYTLRAYARGLRLELTTYLFGQD
FT                   S"
XX
SQ   Sequence 1567 BP; 359 A; 442 C; 408 G; 358 T; 0 other;
     ggtgccaggc tgcccgctag aatgccgtgg gccgcgggac ggcggtgggc atggatcacc        60
     ctgattctga ctattatcgc agtgctgatc caggccgcct ggttgtggct gggcactcaa       120
     aacttcgtct tctctagaga agaaatagcg cagcttgctc gacagtatgc ggggctggac       180
     catgagcttg ccttctctcg gctgatcgtg gagctgcgga ggctgcaccc aggccacgtg       240
     ctgccggatg aggagctgca gtgggtattt gtgaacgcgg gcggctggat gggcgccatg       300
     tgtattctgc acgcctcgct gtctgagtac gtgctgctct tcggcaccgc cctgggctcc       360
     catggccatt cgggacgata ctgggctgag atttctgaca ccatcatctc tggcaccttc       420
     caccaatgga aagagggcac cacgaaaagt gaggtcttct acccaggaga gacagttgta       480
     cacgggcctg gagaagcaac ggctctggag tggggaccaa acacgtggat ggtggagtac       540
     ggccggggtg ttattccgtc taccctgttc tttgcactag ccgacacttt cttcagcacc       600
     caggactacc tcacactctt ctataccctt cgggcctatg cccggggcct ccggcttgag       660
     cttaccacct acctctttgg ccaagactcc tgaccagcca ggcctgaagg aagatctgtg       720
     gatggacagg agcgcggcag gaccacatcc atctctctac tcgctggaac tcatattcag       780
     acagcagcgt ataccatgca gatattaagt acctgctgta tgaggaagga catacatact       840
     tgtacatcca gacacagctc ttgggaagca aatgagacac agagatgcta agacttgtat       900
     gtactgtaag atcatgcact cacatccacc cagaaagggt cctctacata tactccaggg       960
     ggccagtcat gtttgaacac acatcacaag cttgactcac tgactcaggc tttcctagag      1020
     cctcctgctg gcattcaggg ctctgggatc aagggttgag gtagatgtta cacactacct      1080
     cactctgatg cctcattcct gtagtaatct ctggtgaagg gaaagaggag ctgcccttcg      1140
     gaggtcccct tcacctgcag ctatgatgcc cttcccttca tccctttcct caccatatgc      1200
     cttatctcca ttccactccc ctgctatgca aatgcccccc tggcttgtcc tccctgcccc      1260
     ccccccccgg caaccagttc agctgggaaa gcagaggcat gtagaggatg ctaaagggaa      1320
     gggaggtcct ccactacgga gacccttgtt ggggttagaa tgggaaagct ggctagtgcc      1380
     ccagggccag ttcccaagga gaggacctgg agaagtaagc cggggtccaa ggagccaccc      1440
     cattccaaaa gaagccttta gtgtgtgtgt gcacacccta tcagtttcca gacatatctg      1500
     ttgcaatctc tgtcttcttg tctctctctg ttaataaaaa catattaaac aaaaaaaaaa      1560
     aaaaaaa                                                                1567
//


spacer
spacer