spacer

EBI Dbfetch

ID   AF030185; SV 1; linear; mRNA; STD; MUS; 2045 BP.
XX
AC   AF030185;
XX
DT   18-NOV-1997 (Rel. 53, Created)
DT   23-SEP-2008 (Rel. 97, Last updated, Version 2)
XX
DE   Mus musculus putative beta chemokine receptor (E01) mRNA, complete cds.
XX
KW   .
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi; Muroidea;
OC   Muridae; Murinae; Mus; Mus.
XX
RN   [1]
RP   1-2045
RA   Berman M.A., Dorf M.E.;
RT   "Mus. musculus E01 mRNA, complete cds";
RL   Unpublished.
XX
RN   [2]
RP   1-2045
RA   Berman M.A., Dorf M.E.;
RT   ;
RL   Submitted (15-OCT-1997) to the INSDC.
RL   Pathology, Harvard University Medical School, 200 Longwood Avenue, Boston,
RL   MA 02115-5701, USA
XX
DR   MD5; fc5042f7e845673a6dd6bf4ba9e4ae54.
DR   Ensembl-Gn; ENSMUSG00000043953; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000111888; mus_musculus.
DR   EuropePMC; PMC517445; 15322042.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..2045
FT                   /organism="Mus musculus"
FT                   /strain="129/sv"
FT                   /mol_type="mRNA"
FT                   /cell_type="astrocytes; peritoneal exudate"
FT                   /db_xref="taxon:10090"
FT   CDS             445..1527
FT                   /codon_start=1
FT                   /gene="E01"
FT                   /product="putative beta chemokine receptor"
FT                   /db_xref="GOA:O35457"
FT                   /db_xref="InterPro:IPR000276"
FT                   /db_xref="InterPro:IPR000355"
FT                   /db_xref="InterPro:IPR017452"
FT                   /db_xref="MGI:MGI:1920904"
FT                   /db_xref="UniProtKB/Swiss-Prot:O35457"
FT                   /protein_id="AAB86479.1"
FT                   /translation="MDNYTVAPDDEYDVLILDDYLDNSGPDQVPAPEFLSPQQVLQFCC
FT                   AVFAVGLLDNVLAVFILVKYKGLKNLGNIYFLNLALSNLCFLLPLPFWAHTAAHGESPG
FT                   NGTCKVLVGLHSSGLYSEVFSNILLLVQGYRVFSQGRLASIFTTVSCGIVACVLAWAMA
FT                   TALSLPESVFYEPRMERQKHKCAFGKPHFLPIEAPLWKYVLTSKMIILVLAFPLLVFII
FT                   CCRQLRRRQSFRERQYDLHKPALVITGVFLLMWAPYNTVLFLSAFQEHLSLQDEKSSYH
FT                   LDASVQVTQLVATTHCCVNPLLYLLLDRKAFMRYLRSLFPRCNDIPYQSSGGSQQAPPR
FT                   KGHGRPIELYSNLHQRQDII"
XX
SQ   Sequence 2045 BP; 492 A; 509 C; 491 G; 553 T; 0 other;
     gagaagtcaa acttggtata ccgggagagg gagagatgaa aacaacttct cagtttctct        60
     gtggctgaca gaagctcctg agagaggctt tcagaacttg attccagctg gcccgtgaaa       120
     gctgtgtctg gacgggagag cctcagagga ataaacagtg ccttctctgg cttctccggg       180
     tcaagaccag tctgttcaga aggaagtggt gtttctctga ccccactgtt cccacagccc       240
     cctggatggt agatcatggg gctgcaccct tctccaccat tgggaactca gtcaaacggt       300
     tatctttatc tcgccagctt gtcctcgtgc ttgaccagcg cagtttcact tttgcaaaca       360
     tctgtttata tcccttgaga gaaaaatatc aagcaacctg cctcaaacga ccctgttttg       420
     gccggtgagc aaggacagcc tccgatggat aactacacag tggccccgga cgatgaatat       480
     gatgtcctaa tcttagacga ctacctggac aacagtgggc cggaccaagt tccggccccc       540
     gagttcctct ccccccagca ggtgctgcag ttctgctgcg cggtgtttgc ggtgggtctc       600
     ttggacaacg tgctggcggt gtttatcttg gtgaaataca aaggactcaa gaatctgggg       660
     aacatctact tcctaaacct ggcactttca aacctgtgtt tcctgcttcc cctgccgttc       720
     tgggcccata ctgcagcaca cggggaaagc cctggcaacg ggacctgtaa agttcttgtc       780
     ggactccact cctcgggctt atacagcgag gtgttttcca acatcctcct ccttgtgcaa       840
     ggatacaggg tgttttccca agggcgactg gcctccatct tcacgacagt gtcttgtggt       900
     attgttgcgt gcgtcctggc atgggccatg gctactgcgc tctctttgcc cgagtctgtg       960
     ttttatgagc ctcggatgga aagacagaaa cacaagtgtg cctttggcaa acctcacttc      1020
     ttgccaatcg aagcgccgct ctggaagtac gttctgacgt caaaaatgat catcttggta      1080
     cttgcttttc ctctgctggt ttttataatc tgctgcaggc aactgaggag aaggcagagc      1140
     ttcagggaga gacagtacga cctccacaag ccggctcttg tcataacggg cgtgttcctt      1200
     ttgatgtggg cgccttacaa cactgtgctt ttcctgtctg ctttccagga acacttgtcc      1260
     ctgcaggatg agaagagcag ctaccacctg gacgcaagtg ttcaggtcac acagctggta      1320
     gcgaccaccc actgctgcgt caacccgctg ctctatttgc ttcttgaccg gaaggccttt      1380
     atgagatacc ttcgcagcct gttcccacgg tgcaatgata tcccctatca aagtagtgga      1440
     ggctctcagc aagcgccgcc aaggaaaggt catggcaggc ccattgaact gtacagcaat      1500
     ttgcatcaaa ggcaggatat aatataatat aaacactcaa ccttgtctct tcacattgtt      1560
     ttatgccatt tttatatgtt tgtataaaaa tagaatataa gaggaaaggg ggctggttaa      1620
     tgaacattta ctactaagcg ttgaatttgt ctctggcaca cggttaagtt atttataaag      1680
     gtgaattcca ctcttcctct ttagcgtttg tccgcagtgt aggcgtgggg cggtgtgcat      1740
     tccataaact gaagcttggt agttgtccaa agttacataa ttataaagtg gcaaaactga      1800
     tgtgtaaact cagagatcac tggccccaga gtctgtgagt tatccaagcg tgccagcctt      1860
     tcagtaactg tcagctagca gtggtggcat gtctgtcatc ccagcactct aggaggcgga      1920
     ggcaggaggc atctcacaaa tgcaagtata acctgacttc ccccaacctc aattcttttt      1980
     ttttttgttg ttgttgttca tcaaaataca tgcaataaat atatatattt ttaaagcaaa      2040
     aaaaa                                                                  2045
//


spacer
spacer