spacer

EBI Dbfetch

ID   AF029792; SV 1; linear; genomic DNA; STD; MUS; 1152 BP.
XX
AC   AF029792;
XX
DT   08-JAN-1998 (Rel. 54, Created)
DT   03-MAR-2000 (Rel. 62, Last updated, Version 3)
XX
DE   Mus musculus UDP-Gal:betaGlcNAc beta 1,3-galactosyltranferase-III (b3GT3)
DE   gene, complete cds.
XX
KW   .
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi; Muroidea;
OC   Muridae; Murinae; Mus; Mus.
XX
RN   [1]
RP   1-1152
RX   DOI; 10.1074/jbc.273.1.58.
RX   PUBMED; 9417047.
RA   Hennet T., Dinter A., Kuhnert P., Mattu T.S., Rudd P.M., Berger E.G.;
RT   "Genomic cloning and expression of three murine UDP-galactose:
RT   beta-N-acetylglucosamine beta1,3-galactosyltransferase genes";
RL   J Biol Chem 273(1):58-65(1998).
XX
RN   [2]
RP   1-1152
RA   Hennet T., Kuhnert P., Berger E.G.;
RT   ;
RL   Submitted (10-OCT-1997) to the INSDC.
RL   Physiology, University of Zurich, Winterthurerstrasse 190, Zurich, ZH 8057,
RL   Switzerland
XX
DR   MD5; 0347c2b9de6130994f2dec39e28319f0.
DR   Ensembl-Gn; ENSMUSG00000043300; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000061826; mus_musculus.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1152
FT                   /organism="Mus musculus"
FT                   /strain="129/SvJ"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:10090"
FT   CDS             35..1030
FT                   /codon_start=1
FT                   /gene="b3GT3"
FT                   /product="UDP-Gal:betaGlcNAc beta
FT                   1,3-galactosyltranferase-III"
FT                   /note="glycosyltransferase; beta3GalT-III"
FT                   /db_xref="GOA:Q920V1"
FT                   /db_xref="InterPro:IPR002659"
FT                   /db_xref="MGI:MGI:1349405"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q920V1"
FT                   /protein_id="AAC53525.1"
FT                   /translation="MAPAVLTALPNRMSLRSLKWSLLLLSLLSFLVIWYLSLPHYNVIE
FT                   RVNWMYFYEYEPIYRQDFRFTLREHSNCSHQNPFLVILVTSRPSDVKARQAIRVTWGEK
FT                   KSWWGYEVLTFFLLGQQAEREDKTLALSLEDEHVLYGDIIRQDFLDTYNNLTLKTIMAF
FT                   RWVMEFCPNAKYIMKTDTDVFINTGNLVKYLLNLNHSEKFFTGYPLIDNYSYRGFFHKN
FT                   HISYQEYPFKVFPPYCSGLGYIMSGDLVPRVYEMMSHVKPIKFEDVYVGICLNLLKVDI
FT                   HIPEDTNLFFLYRIHLDVCQLRRVIAAHGFSSKEIITFWQVMLRNTTCHY"
XX
SQ   Sequence 1152 BP; 294 A; 281 C; 265 G; 312 T; 0 other;
     aacctgtgcc ttctgaactt ctctgctgct gtggatggcc ccggctgtct tgactgccct        60
     tcccaatagg atgtcactga gatccctcaa gtggagcctg ctgctgctgt ccctgctgag       120
     cttcctggtg atatggtacc tcagcctccc ccactacaat gtgatcgagc gcgtcaactg       180
     gatgtacttc tatgagtatg agccaattta cagacaagac tttcgcttca cgctccgcga       240
     acactcgaac tgttctcatc agaacccatt cctggtcatc ctggtgacct cacgcccctc       300
     agatgtgaaa gccagacaag ccattagagt tacttggggt gagaaaaagt cctggtgggg       360
     atatgaggtg ctcacgtttt tcttactagg ccagcaggct gaaagggaag acaaaacgtt       420
     agccctgtcc ttggaggatg agcacgttct ctatggtgat attatacggc aagactttct       480
     agacacatat aataacttga ccttgaaaac cattatggct ttcaggtggg taatggagtt       540
     ttgccccaat gccaagtata ttatgaaaac agacactgat gttttcatca acactggcaa       600
     tttagtcaag tatcttttaa acctaaacca ctcagagaag tttttcacgg gctatcctct       660
     aattgataac tattcctata gaggattttt ccataaaaac cacatttcat accaagagta       720
     ccccttcaag gtgttccctc cctactgcag cgggctgggc tacattatgt ccggcgacct       780
     ggtgcccagg gtctacgaga tgatgagtca cgtgaagccc atcaagtttg aagacgttta       840
     tgttggcatc tgtttgaatt tgttaaaagt ggacattcat attccagaag acacaaacct       900
     tttctttctg tacagaatcc acttggatgt atgtcagctc agacgcgtga ttgcagccca       960
     tggcttttct tccaaggaga tcatcacatt ctggcaggtg atgctgagga acaccacatg      1020
     ccattactaa gcccatccat cacccatcta ggcaagggag gaaggacact gtagacaggg      1080
     tcagagttag cactgtggga aactcgggaa gttgagcgtg ctggtttgcc tgggctgaaa      1140
     ctcatggagc tc                                                          1152
//


spacer
spacer