Dbfetch

ID   AF029791; SV 1; linear; genomic DNA; STD; MUS; 1473 BP.
XX
AC   AF029791;
XX
DT   08-JAN-1998 (Rel. 54, Created)
DT   15-APR-2005 (Rel. 83, Last updated, Version 4)
XX
DE   Mus musculus UDP-Gal:betaGlcNAc beta 1,3-galactosyltranferase-II (b3GT2)
DE   gene, complete cds.
XX
KW   .
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha; Muroidea; Muridae;
OC   Murinae; Mus; Mus.
XX
RN   [1]
RP   1-1473
RX   DOI; 10.1074/jbc.273.1.58.
RX   PUBMED; 9417047.
RA   Hennet T., Dinter A., Kuhnert P., Mattu T.S., Rudd P.M., Berger E.G.;
RT   "Genomic cloning and expression of three murine UDP-galactose:
RT   beta-N-acetylglucosamine beta1,3-galactosyltransferase genes";
RL   J Biol Chem 273(1):58-65(1998).
XX
RN   [2]
RP   1-1473
RA   Hennet T., Kuhnert P., Berger E.G.;
RT   ;
RL   Submitted (10-OCT-1997) to the INSDC.
RL   Physiology, University of Zurich, Winterthurerstrasse 190, Zurich, ZH 8057,
RL   Switzerland
XX
DR   MD5; 203bfb19e784121dff88b12aeb1d56f3.
DR   Ensembl-Gn; ENSMUSG00000033849; mus_musculus.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0016561; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_AJ_G0016544; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AKRJ_G0016509; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_BALBcJ_G0016504; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_C3HHeJ_G0016329; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0016965; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_CASTEiJ_G0015908; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CBAJ_G0016303; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_DBA2J_G0016409; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_FVBNJ_G0016407; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_LPJ_G0016480; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0016433; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0017001; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0015694; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_WSBEiJ_G0015971; mus_musculus_wsbeij.
DR   Ensembl-Tr; ENSMUST00000038252; mus_musculus.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0022489; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_AJ_T0022459; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AKRJ_T0022426; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_BALBcJ_T0022429; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_C3HHeJ_T0022239; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0022941; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_CASTEiJ_T0021766; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CBAJ_T0022179; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_DBA2J_T0022304; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_FVBNJ_T0022314; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_LPJ_T0022406; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0022283; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0022979; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0021492; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_WSBEiJ_T0021807; mus_musculus_wsbeij.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1473
FT                   /organism="Mus musculus"
FT                   /strain="129/SvJ"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:10090"
FT   CDS             63..1331
FT                   /codon_start=1
FT                   /gene="b3GT2"
FT                   /product="UDP-Gal:betaGlcNAc beta
FT                   1,3-galactosyltranferase-II"
FT                   /note="glycosyltransferase; beta3GalT-II"
FT                   /db_xref="GOA:O54905"
FT                   /db_xref="InterPro:IPR002659"
FT                   /db_xref="MGI:MGI:1349461"
FT                   /db_xref="UniProtKB/Swiss-Prot:O54905"
FT                   /protein_id="AAC53524.1"
FT                   /translation="MLQWRRRHCCFAKMTWSPKRSLLRTPLTGVLSLVFLFAMFLFFNH
FT                   HDWLPGRPGFKENPVTYTFRGFRSTKSETNHSSLRTIWKEVAPQTLRPHIASNSSNTEL
FT                   SPQGVTGLQNTLSANGSIYNEKGTGHPNSYHFKYIINEPEKCQEKSPFLILLIAAEPGQ
FT                   IEARRAIRQTWGNETLAPGIQIIRVFLLGISIKLNGYLQHAIQEESRQYHDIIQQEYLD
FT                   TYYNLTIKTLMGMNWVATYCPHTPYVMKTDSDMFVNTEYLIHKLLKPDLPPRHNYFTGY
FT                   LMRGYAPNRNKDSKWYMPPDLYPSERYPVFCSGTGYVFSGDLAEKIFKVSLGIRRLHLE
FT                   DVYVGICLAKLRVDPVPPPNEFVFNHWRVSYSSCKYSHLITSHQFQPSELIKYWNHLQQ
FT                   NKHNACANAAKEKAGRYRHRKLH"
XX
SQ   Sequence 1473 BP; 470 A; 315 C; 288 G; 400 T; 0 other;
     gaggacggaa caacagtgtt tttggccaca gacatccgtt actgctactg gatacttaca        60
     acatgcttca gtggagaaga cgacactgct gctttgcaaa aatgacctgg agccctaaga       120
     ggtctctgct ccggactccc cttacgggtg tgctttctct agtgtttctc tttgctatgt       180
     tcttgttttt caatcatcat gactggttac caggtagacc aggattcaaa gaaaatcctg       240
     tgacatacac tttccgagga tttcgttcta caaaaagtga gacaaaccat agctcccttc       300
     ggaccatctg gaaagaagta gctcctcaga ctctgaggcc tcacatagca agcaactcca       360
     gtaacaccga gctatcacca cagggagtca cagggctgca gaacactctc agtgccaatg       420
     gcagcattta taatgaaaaa ggaactggac atccaaactc ttaccatttc aaatatatta       480
     tcaatgagcc tgaaaaatgc caagagaaaa gtccattttt aatactatta atagctgcag       540
     aacctggaca aatcgaagca agaagagcta tacggcaaac ttggggcaat gaaactttgg       600
     cacctggcat ccaaatcata cgggtttttt tgttgggcat aagtattaag ctaaatggct       660
     atcttcaaca tgcaattcaa gaagaaagca gacagtatca tgatataatt cagcaggaat       720
     atttagatac atactataat ctgaccatta aaacactaat gggtatgaac tgggttgcaa       780
     catactgtcc acatactccc tatgttatga aaacggacag tgacatgttt gtcaacacag       840
     aatacttaat acacaagtta ctaaagccag acctgcctcc tagacataac tattttactg       900
     gctatctaat gagaggatat gcaccgaaca gaaacaaaga cagtaagtgg tacatgccac       960
     cagaccttta cccaagtgag cgctaccctg tcttctgctc aggaactggt tatgtgtttt      1020
     ctggggatct ggcagagaag atatttaagg tttctttagg tatccgtcgt ttgcacttgg      1080
     aagatgtata tgtagggatc tgtcttgcca agttgagagt tgatcctgtg ccccctccca      1140
     atgagttcgt gttcaatcac tggcgagttt cttattcaag ctgtaaatac agccacctaa      1200
     ttacctctca tcagttccag cctagtgaac tgataaaata ctggaaccat ttacaacaaa      1260
     ataagcacaa cgcctgtgcc aatgcagcaa aggaaaaggc aggcaggtat cgacaccgca      1320
     aactacacta gaagactatt tttgttcaaa tgtggagtct gtaaatattg cttaaagcat      1380
     gtatagttaa aaacttgatt atatacatag gacaagtttt agttcaactc atcacataaa      1440
     ggaattcaaa gctatttttt aaattttctg aat                                   1473
//