Dbfetch

ID   AF029758; SV 1; linear; mRNA; STD; MUS; 2261 BP.
XX
AC   AF029758;
XX
DT   10-MAR-1998 (Rel. 54, Created)
DT   23-SEP-2008 (Rel. 97, Last updated, Version 3)
XX
DE   Mus musculus natural resistance associated macrophage protein-2 (Nramp2)
DE   mRNA, C-terminal exon alternative splice variant, complete cds.
XX
KW   .
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha; Muroidea; Muridae;
OC   Murinae; Mus; Mus.
XX
RN   [1]
RP   1-2261
RX   DOI; 10.1073/pnas.95.3.1148.
RX   PUBMED; 9448300.
RA   Fleming M.D., Romano M.A., Su M.A., Garrick L.M., Garrick M.D.,
RA   Andrews N.C.;
RT   "Nramp2 is mutated in the anemic Belgrade (b) rat: evidence of a role for
RT   Nramp2 in endosomal iron transport";
RL   Proc. Natl. Acad. Sci. U.S.A. 95(3):1148-1153(1998).
XX
RN   [2]
RP   1-2261
RA   Fleming M.D., Romano M.A., Su M.A., Garrick L.M., Garrick M.D.,
RA   Andrews N.C.;
RT   ;
RL   Submitted (14-OCT-1997) to the INSDC.
RL   Hematology/Oncology, Children's Hospital, Boston, 320 Longwood Avenue,
RL   Boston, MA 02115, USA
XX
DR   MD5; 13ec65a3328fa8e7b91454570b18ee6d.
DR   Ensembl-Gn; ENSMUSG00000023030; mus_musculus.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0022350; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_AJ_G0022312; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AKRJ_G0022288; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_BALBcJ_G0022316; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_C3HHeJ_G0022086; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0022764; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_CASTEiJ_G0021611; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CBAJ_G0022055; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_DBA2J_G0022182; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_FVBNJ_G0022161; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_LPJ_G0022253; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0022182; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0022778; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0021350; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_WSBEiJ_G0021661; mus_musculus_wsbeij.
DR   Ensembl-Tr; ENSMUST00000023774; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000138843; mus_musculus.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0042605; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_AJ_T0042569; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AKRJ_T0042533; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_BALBcJ_T0042560; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_C3HHeJ_T0042296; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0043045; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_CASTEiJ_T0042396; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CBAJ_T0042210; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_DBA2J_T0042361; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_FVBNJ_T0042326; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_LPJ_T0042432; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0042304; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0043083; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0041978; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_WSBEiJ_T0041686; mus_musculus_wsbeij.
DR   EuropePMC; PMC15909; 10077651.
DR   EuropePMC; PMC18702; 9448300.
DR   EuropePMC; PMC368157; 15024413.
DR   RFAM; RF02253; IRE_II.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..2261
FT                   /organism="Mus musculus"
FT                   /chromosome="15"
FT                   /strain="DBA origin"
FT                   /mol_type="mRNA"
FT                   /cell_line="Mouse erythroleukemia (MEL) cell line"
FT                   /db_xref="taxon:10090"
FT   CDS             68..1753
FT                   /codon_start=1
FT                   /gene="Nramp2"
FT                   /product="natural resistance associated macrophage
FT                   protein-2"
FT                   /note="C-terminal exon alternative splice variant"
FT                   /db_xref="GOA:P49282"
FT                   /db_xref="InterPro:IPR001046"
FT                   /db_xref="MGI:MGI:1345279"
FT                   /db_xref="UniProtKB/Swiss-Prot:P49282"
FT                   /protein_id="AAC24496.1"
FT                   /translation="MVLDPKEKMPDDGASGDHGDSASLGAINPAYSNSSLPHSTGDSEE
FT                   PFTTYFDEKIPIPEEEYSCFSFSKLWAFTGPGFLMSIAYLDPGNIESDLQSGAVAGFKL
FT                   LWVLLLATIVGLLLQRLAARLGVVTGLHLAEVCHRQYPKVPRIILWLMVELAIIGSDMQ
FT                   EVIGSAIAINLLSAGRVPLWGGVLITIADTFVFLFLDKYGLRKLEAFFGFLITIMALTF
FT                   GYEYITVKPSQSQVLRGMFVPSCPGCRTPQVEQAVGIVGAVIMPHNMYLHSALVKSRQV
FT                   NRANKQEVREANKYFFIESCIALFVSFIINVFVVSVFAEAFFEKTNKQVVEVCKNNSSP
FT                   HADLFPSDNSTLAVDIYKGGVVLGCYFGPAALYIWAVGILAAGQSSTMTGTYSGQFVME
FT                   GFLNLKWSRFARVILTRSIAIIPTLLVAVFQDVEHLTGMNDFLNVLQSLQLPFALIPIL
FT                   TFTSLRPVMSEFSNGIGWRIAGGILVLIVCSINMYFVVVYVQELGHVALYVVAAVVSVA
FT                   YLTFVFYLGWQCLIALGLSFLDCGRSVSISKVLLSEDTSGGNIK"
XX
SQ   Sequence 2261 BP; 467 A; 550 C; 606 G; 638 T; 0 other;
     cgggcggcgt gtgtggaggt ggcggacgaa tccctattct aagagcacag accctcaggt        60
     atctaccatg gtgttggatc ctaaagaaaa gatgccagac gatggcgctt ctggggacca       120
     tggagactct gccagccttg gcgccatcaa ccctgcctac agcaactcat ccctcccaca       180
     ttccactgga gactctgagg agcccttcac cacctacttt gatgagaaaa tccccattcc       240
     tgaggaggag tactcttgtt ttagctttag taaactctgg gcgttcacgg ggcctggctt       300
     tcttatgagc attgcctacc tagacccagg aaacatcgaa tctgatttgc agtctggagc       360
     agtggctgga tttaagctgc tctgggtgct cctcttggcc accattgtgg ggctgctgct       420
     ccagcgcctt gcagcgagac ttggagtggt caccggcttg catcttgctg aagtatgtca       480
     ccgtcagtat cccaaggtcc cacggatcat cctgtggctg atggtggagt tggcaatcat       540
     tggttctgac atgcaggaag tcattggctc agccatcgcc atcaatctcc tgtctgcagg       600
     aagggtcccc ctgtggggcg gagtcctcat caccatcgca gacacttttg tgtttctttt       660
     tttggacaaa tatggcttgc ggaagctgga agcgtttttt ggctttctca tcactatcat       720
     ggccctcacg tttggatatg agtacattac agtgaagccc agccagagcc aagtactcag       780
     gggcatgttc gtgccgtcct gtccagggtg ccgcacccct caggtggagc aggcggtggg       840
     catcgtggga gctgtgatca tgccgcacaa catgtacctg cattctgcct tagtcaagtc       900
     tagacaggtg aatcgggcca ataagcagga agtgcgggaa gccaataagt acttcttcat       960
     cgagtcctgc atcgcgctct ttgtttcctt catcatcaat gtctttgtcg tgtccgtctt      1020
     tgctgaagca ttttttgaga aaaccaacaa gcaggtggtt gaagtctgca aaaataacag      1080
     cagcccccat gctgacctct ttcccagtga caactctact ctggctgtgg acatctacaa      1140
     agggggtgtt gtgcttggat gttacttcgg gcctgcagct ctctacatct gggcagtggg      1200
     gatcctggct gccggtcaga gctccaccat gactggaacc tattctggcc agtttgtcat      1260
     ggagggattc ctgaacctaa aatggtcgcg ctttgcccga gtgatcctga cccggtctat      1320
     cgccatcatc cccaccctgc tcgtcgctgt cttccaggat gtggagcacc taacggggat      1380
     gaatgacttc ctgaatgtcc tgcagagctt acagctcccc tttgctctca tacccatcct      1440
     cacgttcaca agcctgcggc cagtgatgag tgagttttcc aatggaatag gctggaggat      1500
     tgccggtggc atcctggtcc tgatcgtctg ctccatcaac atgtactttg tagtggttta      1560
     tgtccaggag ctagggcatg tggcactcta tgtggtggct gcagtggtta gcgtggctta      1620
     tttgaccttt gtgttctact tgggttggca gtgtttgatt gcattgggtc tgtctttcct      1680
     ggactgtgga cgctcggtaa gcatctcgaa agtcctgctg agcgaagata ccagcggtgg      1740
     caacattaag taaacactgg atcagtctgt ctgtctttgc agggagccat cagagccagt      1800
     gtgtttctat ggtttactgt gtgaacatag ccacaagtat gtgctgttgc acagactgca      1860
     tttaggactc aactgttagt tgggaaacac tgatgtgtgt gtgtgtgtgt gtgtatatgt      1920
     gtgtgtgtgt gtgtgttaag gtctttgttt ccttttgttt ttgtgaatag catcttgcta      1980
     ttaaatacta ggttgcctaa aactcactat ggtagcttag gctgtgctca aacctacagc      2040
     aatccttctg acctaagctc ctgagtgctg ggccaggcac gtctaccatg cctggctgtc      2100
     atgtatgctt aagatgagtt ttgttggggg tcagggtggg ggggtagggg gtcttaccct      2160
     gtagcattag gcagcacctt gaaaaggtgc ccttgagctg ttttaaacac taagtttcaa      2220
     atagctgccc aaggcagtag cttgttttta gtcaaaacaa a                          2261
//