spacer

EBI Dbfetch

ID   AF022801; SV 1; linear; mRNA; STD; MUS; 352 BP.
XX
AC   AF022801;
XX
DT   06-JAN-1999 (Rel. 58, Created)
DT   15-APR-2005 (Rel. 83, Last updated, Version 3)
XX
DE   Mus musculus phospholipase C beta-1 (Plcb1) mRNA, partial cds.
XX
KW   .
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi; Muroidea;
OC   Muridae; Murinae; Mus; Mus.
XX
RN   [1]
RP   1-352
RX   DOI; 10.1046/j.1460-9568.1998.00213.x.
RX   PUBMED; 9753089.
RA   Watanabe M., Nakamura M., Sato K., Kano M., Simon M.I., Inoue Y.;
RT   "Patterns of expression for the mRNA corresponding to the four isoforms of
RT   phospholipase Cbeta in mouse brain";
RL   Eur. J. Neurosci. 10(6):2016-2025(1998).
XX
RN   [2]
RP   1-352
RA   Watanabe M., Nakamura M., Sato K.;
RT   ;
RL   Submitted (05-SEP-1997) to the INSDC.
RL   Anatomy, Hokkaido University School of Medicine, N15W7, Kita-ku, Sapporo
RL   060, Japan
XX
DR   MD5; a96c120b5b23e1c986ca174879238c37.
DR   Ensembl-Gn; ENSMUSG00000051177; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000070724; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000110116; mus_musculus.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..352
FT                   /organism="Mus musculus"
FT                   /strain="C57BL"
FT                   /mol_type="mRNA"
FT                   /db_xref="taxon:10090"
FT   CDS             <1..>352
FT                   /codon_start=2
FT                   /gene="Plcb1"
FT                   /product="phospholipase C beta-1"
FT                   /db_xref="GOA:Q9Z1B3"
FT                   /db_xref="InterPro:IPR000008"
FT                   /db_xref="InterPro:IPR000909"
FT                   /db_xref="InterPro:IPR001192"
FT                   /db_xref="InterPro:IPR001711"
FT                   /db_xref="InterPro:IPR009535"
FT                   /db_xref="InterPro:IPR011992"
FT                   /db_xref="InterPro:IPR014815"
FT                   /db_xref="InterPro:IPR015359"
FT                   /db_xref="InterPro:IPR016280"
FT                   /db_xref="InterPro:IPR017946"
FT                   /db_xref="InterPro:IPR028400"
FT                   /db_xref="MGI:MGI:97613"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9Z1B3"
FT                   /protein_id="AAD01749.1"
FT                   /translation="VKWDDDSTIVTPIILRTDPQGFFFYWTDQNKETELLDLTLVKDAR
FT                   CGKHAKAPKDPKLRELLDVGNIGHLEQRMITVVYGPDLVNISHLNLVAFQEEVAKEWTN
FT                   EVFSLATNLLAQN"
XX
SQ   Sequence 352 BP; 95 A; 76 C; 92 G; 89 T; 0 other;
     cgtcaagtgg gatgatgact ccactattgt tactccaatt attttgagga ctgatcctca        60
     gggatttttc ttttactgga cagaccagaa taaggagacg gagctgttag atctcaccct       120
     tgtcaaggat gccaggtgtg ggaagcacgc caaagctccc aaggacccca agttgcgtga       180
     acttctggat gttgggaaca tcggacactt ggaacagcgc atgataactg tggtgtatgg       240
     accagacctg gtgaacattt cccacttgaa tcttgtggct tttcaagagg aagtagccaa       300
     ggaatggaca aatgaggttt tcagcttggc aacaaacctg ctggctcaga ac               352
//


spacer
spacer