spacer

EBI Dbfetch

ID   AF021819; SV 1; linear; mRNA; STD; HUM; 900 BP.
XX
AC   AF021819;
XX
DT   03-OCT-1997 (Rel. 52, Created)
DT   07-OCT-2008 (Rel. 97, Last updated, Version 4)
XX
DE   Homo sapiens RNA-binding protein regulatory subunit mRNA, complete cds.
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-900
RA   Beaudoin R., Hod Y.;
RT   ;
RL   Submitted (28-AUG-1997) to the INSDC.
RL   Urology, SUNY at Stony Brook, Health Science Center, Stony Brook, NY
RL   11794-8093, USA
XX
DR   MD5; 91c0041cabbf291dd01d57c34a6aa38c.
DR   Ensembl-Gn; ENSG00000116288; homo_sapiens.
DR   Ensembl-Tr; ENST00000338639; homo_sapiens.
DR   Ensembl-Tr; ENST00000377488; homo_sapiens.
DR   Ensembl-Tr; ENST00000377491; homo_sapiens.
DR   Ensembl-Tr; ENST00000493373; homo_sapiens.
DR   Ensembl-Tr; ENST00000493678; homo_sapiens.
DR   EuropePMC; PMC1735689; 14985393.
DR   EuropePMC; PMC186627; 12097342.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..900
FT                   /organism="Homo sapiens"
FT                   /mol_type="mRNA"
FT                   /tissue_type="lung"
FT                   /db_xref="taxon:9606"
FT   5'UTR           1..71
FT   CDS             72..641
FT                   /codon_start=1
FT                   /product="RNA-binding protein regulatory subunit"
FT                   /db_xref="GOA:Q99497"
FT                   /db_xref="H-InvDB:HIT000062576.13"
FT                   /db_xref="HGNC:HGNC:16369"
FT                   /db_xref="InterPro:IPR002818"
FT                   /db_xref="InterPro:IPR006287"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="PDB:1J42"
FT                   /db_xref="PDB:1P5F"
FT                   /db_xref="PDB:1PDV"
FT                   /db_xref="PDB:1PDW"
FT                   /db_xref="PDB:1PE0"
FT                   /db_xref="PDB:1Q2U"
FT                   /db_xref="PDB:1SOA"
FT                   /db_xref="PDB:1UCF"
FT                   /db_xref="PDB:2OR3"
FT                   /db_xref="PDB:2R1T"
FT                   /db_xref="PDB:2R1U"
FT                   /db_xref="PDB:2R1V"
FT                   /db_xref="PDB:2RK3"
FT                   /db_xref="PDB:2RK4"
FT                   /db_xref="PDB:2RK6"
FT                   /db_xref="PDB:3B36"
FT                   /db_xref="PDB:3B38"
FT                   /db_xref="PDB:3B3A"
FT                   /db_xref="PDB:3BWE"
FT                   /db_xref="PDB:3CY6"
FT                   /db_xref="PDB:3CYF"
FT                   /db_xref="PDB:3CZ9"
FT                   /db_xref="PDB:3CZA"
FT                   /db_xref="PDB:3EZG"
FT                   /db_xref="PDB:3F71"
FT                   /db_xref="PDB:3SF8"
FT                   /db_xref="PDB:4BTE"
FT                   /db_xref="PDB:4MNT"
FT                   /db_xref="PDB:4MTC"
FT                   /db_xref="PDB:4N0M"
FT                   /db_xref="PDB:4N12"
FT                   /db_xref="PDB:4OGF"
FT                   /db_xref="PDB:4OQ4"
FT                   /db_xref="PDB:4P2G"
FT                   /db_xref="PDB:4P34"
FT                   /db_xref="PDB:4P35"
FT                   /db_xref="PDB:4P36"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q99497"
FT                   /protein_id="AAC12806.1"
FT                   /translation="MASKRALVILAKGAEEMETVIPVDVMRRAGIKVTVAGLAGKDPVQ
FT                   CSRDVVICPDASLEDAKKEGPYDVVVLPGGNLGAQNLSESAAVKEILKEQENRKGLIAA
FT                   ICAGPTALLAHEIGFGSKVTTHPLAKDKMMNGGHYTYSENRVEKDGLILTSRGPGTSFE
FT                   FALAIVEALNGKEVAAQVKAPLVLKD"
FT   3'UTR           642..900
FT   regulatory      844..850
FT                   /regulatory_class="polyA_signal_sequence"
XX
SQ   Sequence 900 BP; 273 A; 178 C; 237 G; 212 T; 0 other;
     ggcacgagcg tgcgtgctgg cgtgcgttca ctttcagcct ggtgtggggc ttgtaaacat        60
     ataacataaa aatggcttcc aaaagagctc tggtcatcct ggctaaagga gcagaggaaa       120
     tggagacggt catccctgta gatgtcatga ggcgagctgg gattaaggtc accgttgcag       180
     gcctggctgg aaaagaccca gtacagtgta gccgtgatgt ggtcatttgt cctgatgcca       240
     gccttgaaga tgcaaaaaaa gagggaccat atgatgtggt ggttctacca ggaggtaatc       300
     tgggcgcaca gaatttatct gagtctgctg ctgtgaagga gatactgaag gagcaggaaa       360
     accggaaggg cctgatagcc gccatctgtg caggtcctac tgctctgttg gctcatgaaa       420
     taggttttgg aagtaaagtt acaacacacc ctcttgctaa agacaaaatg atgaatggag       480
     gtcattacac ctactctgag aatcgtgtgg aaaaagacgg cctgattctt acaagccggg       540
     ggcctgggac cagcttcgag tttgcgcttg caattgttga agccctgaat ggcaaggagg       600
     tggcggctca agtgaaggct ccacttgttc ttaaagacta gagcagcgaa ctgcgacgat       660
     cacttagaga aacaggccgt taggaatcca ttctcactgt gttcgctcta aacaaaacag       720
     tggtaggtta atgtgttcag aagtcgctgt ccttactact tttgcggaag tatggaagtc       780
     acaactacac agagatttct cagcctacaa attgtgtcta tacatttcta agccttgttt       840
     gcagaataaa cagggcattt agcaaaaaaa aaaaaaaaaa aaaaaaaaaa aaaaaaaaaa       900
//


spacer
spacer