Dbfetch

ID   AF019979; SV 1; linear; mRNA; STD; MUS; 1237 BP.
XX
AC   AF019979;
XX
DT   04-JAN-1999 (Rel. 58, Created)
DT   23-SEP-2008 (Rel. 97, Last updated, Version 5)
XX
DE   Mus musculus enamel matrix serine proteinase 1 precursor, mRNA, complete
DE   cds.
XX
KW   .
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha; Muroidea; Muridae;
OC   Murinae; Mus; Mus.
XX
RN   [1]
RP   1-1237
RX   PUBMED; 10690663.
RA   Hu J.C.-C., Ryu O.H., Chen J.J., Uchida T., Wakida K., Murakami C.,
RA   Jiang H., Qian Q., Zhang C., Ottmers V., Bartlett J.D., Simmer J.P.;
RT   "Localization of EMSP1 expression during tooth formation and cloning of
RT   mouse cDNA";
RL   J. Dent. Res. 79(1):70-76(2000).
XX
RN   [2]
RP   1-1237
RX   DOI; 10.1016/S0378-1119(00)00203-1.
RX   PUBMED; 10863090.
RA   Hu J.C., Zhang C., Sun X., Yang Y., Cao X., Ryu O., Simmer J.P.;
RT   "Characterization of the mouse and human PRSS17 genes, their relationship
RT   to other serine proteases, and the expression of PRSS17 in developing mouse
RT   incisors";
RL   Gene 251(1):1-8(2000).
XX
RN   [3]
RP   1-1237
RA   Simmer J.;
RT   "Enamel Matrix Serine Proteinase 1 (EMSP1)";
RL   Unpublished.
XX
RN   [4]
RP   1-1237
RA   Simmer J.;
RT   ;
RL   Submitted (18-AUG-1997) to the INSDC.
RL   Pediatric Dentistry, University of Texas Health Science Center at San
RL   Antonio, 7703 Floyd Curl Drive, San Antonio, TX 78284-7888, USA
XX
DR   MD5; c357c353fb95aa2f121016d02b454113.
DR   Ensembl-Gn; ENSMUSG00000006948; mus_musculus.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0032147; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_AJ_G0032132; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AKRJ_G0032062; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_BALBcJ_G0032137; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_C3HHeJ_G0031853; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0032621; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_CASTEiJ_G0031183; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CBAJ_G0031822; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_DBA2J_G0031971; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_FVBNJ_G0031932; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_LPJ_G0032050; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0031968; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0032641; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0030904; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_WSBEiJ_G0031297; mus_musculus_wsbeij.
DR   Ensembl-Tr; ENSMUST00000007161; mus_musculus.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0083511; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_AJ_T0083577; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AKRJ_T0083519; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_BALBcJ_T0083543; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_C3HHeJ_T0083119; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0084034; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_CASTEiJ_T0083639; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CBAJ_T0083069; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_DBA2J_T0083247; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_FVBNJ_T0083112; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_LPJ_T0083260; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0083151; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0084308; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0083060; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_WSBEiJ_T0082178; mus_musculus_wsbeij.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1237
FT                   /organism="Mus musculus"
FT                   /strain="Swiss-Webster"
FT                   /mol_type="mRNA"
FT                   /cell_type="ameloblast"
FT                   /db_xref="taxon:10090"
FT   sig_peptide     52..126
FT   CDS             52..819
FT                   /codon_start=1
FT                   /product="enamel matrix serine proteinase 1 precursor"
FT                   /function="degradation of the enamel matrix during enamel
FT                   maturation"
FT                   /note="EMSP1"
FT                   /db_xref="GOA:Q9Z0M1"
FT                   /db_xref="InterPro:IPR001254"
FT                   /db_xref="InterPro:IPR001314"
FT                   /db_xref="InterPro:IPR009003"
FT                   /db_xref="InterPro:IPR018114"
FT                   /db_xref="InterPro:IPR033116"
FT                   /db_xref="MGI:MGI:1861379"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9Z0M1"
FT                   /protein_id="AAC98894.1"
FT                   /translation="MMVTARTPWGWFLGCLILEVTGASASSVSSRIIQGQDCSPHSQPW
FT                   QAALFSEDGFFCSGVLVHPQWVLSAAHCLQESYIVGLGLHNLKGSQEPGSRMLEAHLSI
FT                   QHPNFNDPSFANDLMLIKLNESVIESNTIRSIPVATQCPTPGDTCLVSGWGQLKNGKLP
FT                   SLLQCVNLSVASEETCRLLYDPVYHLSMFCAGGGQDQKDSCNGDSGGPIVCNRSLQGLV
FT                   SMGQGKCGQPGIPSVYTNLCKFTNWIQTIIQTN"
FT   misc_feature    127..144
FT                   /note="encodes propeptide"
FT   mat_peptide     145..816
FT                   /product="matrix serine proteinase 1"
XX
SQ   Sequence 1237 BP; 289 A; 386 C; 286 G; 276 T; 0 other;
     ttagctcagc tcagccgcag aattcggagc ccagaagcag caggagccaa catgatggtc        60
     actgcacgaa ccccctgggg ctggttcctg gggtgcctca tccttgaggt cacaggagcc       120
     tccgcctcaa gtgtcagcag ccggatcata caaggccagg actgctcccc acactcgcaa       180
     ccctggcagg cggcactgtt ctcagaagac ggttttttct gctcgggagt cttggtgcat       240
     ccgcagtggg tgctgtcagc agcacattgc ttacaggagt cctacatcgt gggactgggc       300
     ctgcataacc tgaaaggctc ccaagagcct ggcagccgga tgttagaggc ccacctctcc       360
     atccagcacc ccaacttcaa cgatccttct tttgcaaacg atctcatgct catcaaactg       420
     aacgagtcag tgatagagtc taacactatc aggagcatcc ctgtggctac ccaatgcccc       480
     actcctggag atacctgcct agtctctggt tggggtcaac taaagaatgg gaaactgccc       540
     agcctcctgc agtgtgtgaa tctctcagtg gcgtcagagg agacttgccg gctgctgtat       600
     gaccctgtgt accacctcag tatgttctgc gctggaggag gacaggacca aaaggactcc       660
     tgcaatgggg actctggggg tcccatagtg tgcaacagat ccctacaagg gctcgtgtct       720
     atgggacaag gaaagtgtgg gcagcctggc ataccaagtg tctacaccaa tctctgcaag       780
     ttcactaact ggatccagac catcattcag acaaactagc tatggactga ctacaaggcc       840
     cacatgaagc ctgctgaggg aacctgagac tcaggattgc tcctagccct tctccctcag       900
     atctacaagg tcaggcccta gcctcctccc tcagactcac aagtccagac tccaatctcc       960
     tccctcagac ccacaagtcc agactccaat ttcctctctc agatccaagg attcagacca      1020
     caataccctc tttcagattc agggatccat gccacaacct cctccctgga acacaggagt      1080
     ggaacccacc tgcattttcc tctgtgtgca gtgtcctcta gtagcccagt attgacccag      1140
     ccttgccttt gtcaccctta ggcttgtttc cccccccaaa caccttatgc ctgtctcctc      1200
     agggatccac aaataaaaga cctctcagtt ctgtttg                               1237
//