spacer

EBI Dbfetch

ID   AF017439; SV 1; linear; mRNA; STD; HUM; 330 BP.
XX
AC   AF017439;
XX
DT   23-SEP-1997 (Rel. 52, Created)
DT   17-JUN-2008 (Rel. 96, Last updated, Version 5)
XX
DE   Homo sapiens MHC class II antigen (HLA-DRB1) mRNA, partial cds.
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-330
RA   Kim K.H., Kang J.H., Maeng C.Y., Han H., Park J.H., Hahm K.S., Kim K.L.;
RT   ;
RL   Submitted (08-AUG-1997) to the INSDC.
RL   Peptide Engineering R. U., KRIBB, P. O. box 115, Yusong, Taejon 305-600,
RL   Korea
XX
DR   MD5; 61d4e17a3c099a0c700f3a9dbb16b7c2.
DR   Ensembl-Gn; ENSG00000206240; homo_sapiens.
DR   Ensembl-Gn; ENSG00000206306; homo_sapiens.
DR   Ensembl-Gn; ENSG00000228080; homo_sapiens.
DR   Ensembl-Tr; ENST00000328980; homo_sapiens.
DR   Ensembl-Tr; ENST00000399450; homo_sapiens.
DR   Ensembl-Tr; ENST00000412634; homo_sapiens.
DR   Ensembl-Tr; ENST00000415796; homo_sapiens.
DR   Ensembl-Tr; ENST00000419393; homo_sapiens.
DR   Ensembl-Tr; ENST00000428566; homo_sapiens.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..330
FT                   /organism="Homo sapiens"
FT                   /chromosome="6"
FT                   /mol_type="mRNA"
FT                   /haplotype="HLA-DR12"
FT                   /clone="KT20"
FT                   /cell_line="EBV-transformed B-cell line KT"
FT                   /db_xref="taxon:9606"
FT   CDS             <1..>330
FT                   /codon_start=1
FT                   /gene="HLA-DRB1"
FT                   /product="MHC class II antigen HLA-DRB1"
FT                   /db_xref="GOA:Q95IE3"
FT                   /db_xref="HGNC:HGNC:4948"
FT                   /db_xref="IMGT/HLA:DRB1*12:06"
FT                   /db_xref="InterPro:IPR000353"
FT                   /db_xref="InterPro:IPR003006"
FT                   /db_xref="InterPro:IPR003597"
FT                   /db_xref="InterPro:IPR007110"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR014745"
FT                   /protein_id="AAB70553.1"
FT                   /translation="ESWNSQKDILEDRRAAVDTYCRHNYGAVESFTVQRRVHPKVTVYP
FT                   SKTQPLQHHNLLVCSVSGFYPGSIEVRWFRNGQEEKTGVVSTGLIQNGDWTFQTLVMLE
FT                   TVPRSG"
XX
SQ   Sequence 330 BP; 77 A; 86 C; 103 G; 64 T; 0 other;
     gagtcctgga acagccagaa ggacatcctg gaagacaggc gcgccgcggt ggacacctat        60
     tgcagacaca actacggggc tgtggagagc ttcacagtgc agcggcgagt ccatcctaag       120
     gtgactgtgt atccttcaaa gacccagccc ctgcagcacc acaacctcct ggtctgttct       180
     gtgagtggtt tctatccagg cagcattgaa gtcaggtggt tccggaatgg ccaggaagag       240
     aagactgggg tggtgtccac gggcctgatc cagaatggag actggacctt ccagaccctg       300
     gtgatgctgg aaacagttcc tcggagtgga                                        330
//


spacer
spacer