spacer

EBI Dbfetch

ID   AF016620; SV 1; linear; mRNA; STD; MUS; 842 BP.
XX
AC   AF016620;
XX
DT   29-OCT-1997 (Rel. 53, Created)
DT   23-SEP-2008 (Rel. 97, Last updated, Version 2)
XX
DE   Mus musculus Rb-8 neural cell adhesion molecule long form (RNCAM) mRNA,
DE   partial cds.
XX
KW   .
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi; Muroidea;
OC   Muridae; Murinae; Mus; Mus.
XX
RN   [1]
RP   1-842
RX   DOI; 10.1074/jbc.272.42.26083.
RX   PUBMED; 9334170.
RA   Alenius M., Bohm S.;
RT   "Identification of a novel neural cell adhesion molecule-related gene with
RT   a potential role in selective axonal projection";
RL   J Biol Chem 272(42):26083-26086(1997).
XX
RN   [2]
RP   1-842
RA   Alenius M., Bohm S.;
RT   ;
RL   Submitted (28-JUL-1997) to the INSDC.
RL   Cell and Molecular Biology, Umea University, Umea S-901 87, Sweden
XX
DR   MD5; 16ed8a1df07caa43fc5e29e17313b459.
DR   Ensembl-Gn; ENSMUSG00000022762; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000067602; mus_musculus.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..842
FT                   /organism="Mus musculus"
FT                   /strain="C57BL/6J"
FT                   /mol_type="mRNA"
FT                   /cell_type="olfactory sensory neurons"
FT                   /tissue_type="olfactory epithelium"
FT                   /db_xref="taxon:10090"
FT   CDS             <1..683
FT                   /codon_start=3
FT                   /gene="RNCAM"
FT                   /product="Rb-8 neural cell adhesion molecule long form"
FT                   /note="alternatively spliced variant"
FT                   /db_xref="GOA:Q71VC5"
FT                   /db_xref="InterPro:IPR003961"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="MGI:MGI:97282"
FT                   /db_xref="UniProtKB/TrEMBL:Q71VC5"
FT                   /experiment="experimental evidence, no additional details
FT                   recorded"
FT                   /protein_id="AAC53376.1"
FT                   /translation="SITKQDDGGAPILEYIVKYRSKDKEDQWLEKKVQGNKDHIILEHL
FT                   QWTMGYEVQITAANRLGYSEPTVYEFSMPPKPNIIKDTLFNGLGLGAIIGLGVAALLLI
FT                   LVVTDVSCFFIRQCGLLMCITRRMCGKKSGSSGKSKELEEGKAAYLKDGSKEPIVEMRT
FT                   EDERITNHEDGSPVNEPNETTPLTEPEKLPLKEENGKEVLNAETIEIKVSNDIIQSKED
FT                   DIKA"
FT   misc_feature    288..365
FT                   /gene="RNCAM"
FT                   /note="transmembrane-region site"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
XX
SQ   Sequence 842 BP; 303 A; 167 C; 187 G; 185 T; 0 other;
     tcagcatcac caagcaagat gatggagggg ctcctatttt agaatacatt gtaaaataca        60
     gaagtaaaga caaggaagat cagtggctag agaagaaggt acagggaaat aaagaccaca       120
     ttatcttgga gcatctgcag tggacaatgg gctacgaagt gcaaatcaca gctgccaaca       180
     gactgggata ttctgagcct actgtatatg agttcagcat gcccccaaaa cccaacatta       240
     ttaaagacac actttttaat ggccttggcc taggagccat cattggcctt ggagttgctg       300
     cccttttgct aatccttgtg gtaacagacg tcagctgctt cttcattcga caatgtgggt       360
     tactaatgtg catcaccagg agaatgtgcg ggaaaaagag tggctccagt gggaaaagta       420
     aagaacttga agaaggaaaa gcagcttacc tgaaagatgg atcaaaagaa ccgatagtgg       480
     aaatgagaac agaagatgaa agaatcacta accatgaaga tgggagtcca gtaaatgagc       540
     caaatgaaac cacaccgcta acagaacctg aaaaattgcc tttaaaagaa gaaaacggaa       600
     aggaagtttt aaacgcagaa actatagaaa ttaaagtgtc caatgacatc atccagtcta       660
     aagaagatga cataaaggca tgacaacaag tttcagcacc ttggtcagca cctcaaggag       720
     catttggttt ggagtgacac tatgaccaaa actattccat tgaccttaat ttctcgggaa       780
     aagtctagct tggaatagct tgtacacata tacatacgac aaactcctct ggccacaacc       840
     ca                                                                      842
//


spacer
spacer