spacer

EBI Dbfetch

ID   AF016619; SV 1; linear; mRNA; STD; MUS; 3485 BP.
XX
AC   AF016619;
XX
DT   29-OCT-1997 (Rel. 53, Created)
DT   23-SEP-2008 (Rel. 97, Last updated, Version 3)
XX
DE   Mus musculus Rb-8 neural cell adhesion molecule short form precursor
DE   (RNCAM) mRNA, complete cds.
XX
KW   .
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi; Muroidea;
OC   Muridae; Murinae; Mus; Mus.
XX
RN   [1]
RP   1-3485
RX   DOI; 10.1074/jbc.272.42.26083.
RX   PUBMED; 9334170.
RA   Alenius M., Bohm S.;
RT   "Identification of a novel neural cell adhesion molecule-related gene with
RT   a potential role in selective axonal projection";
RL   J Biol Chem 272(42):26083-26086(1997).
XX
RN   [2]
RP   1-3485
RA   Alenius M., Bohm S.;
RT   ;
RL   Submitted (28-JUL-1997) to the INSDC.
RL   Cell and Molecular Biology, Umea University, Umea S-901 87, Sweden
XX
DR   MD5; 9ac71ba956c4906ca9a070c9c0381b83.
DR   Ensembl-Gn; ENSMUSG00000022762; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000037785; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000067602; mus_musculus.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..3485
FT                   /organism="Mus musculus"
FT                   /strain="C57BL/6J"
FT                   /mol_type="mRNA"
FT                   /cell_type="olfactory sensory neurons"
FT                   /tissue_type="olfactory epithelium"
FT                   /db_xref="taxon:10090"
FT   CDS             100..2283
FT                   /codon_start=1
FT                   /gene="RNCAM"
FT                   /product="Rb-8 neural cell adhesion molecule short form
FT                   precursor"
FT                   /db_xref="GOA:O35136"
FT                   /db_xref="InterPro:IPR003598"
FT                   /db_xref="InterPro:IPR003961"
FT                   /db_xref="InterPro:IPR007110"
FT                   /db_xref="InterPro:IPR009138"
FT                   /db_xref="InterPro:IPR013098"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="MGI:MGI:97282"
FT                   /db_xref="UniProtKB/Swiss-Prot:O35136"
FT                   /protein_id="AAC53375.1"
FT                   /translation="MSLLLSFYLLGLLVRSGQALLQVTISLSKVELSVGESKFFTCTAI
FT                   GEPESIDWYNPQGEKIISTQRVMLQKEGVRSRLTIYNANIEDAGIYRCQATDAKGQTQE
FT                   ATVVLEIYQKLTFREVVSPQEFKQGEDAEVVCRVSSSPAPAVSWLYHNEEVTTIPDNRF
FT                   AVLANNNLQILNINKSDEGIYRCEGRVEARGEIDFRDIIVIVNVPPAIMMPQKSFNATA
FT                   ERGEEMTLTCKASGSPDPTISWFRNGKLIEENEKYILKGSNTELTVRNIINKDGGSYVC
FT                   KATNKAGEDQKQAFLQVFVQPHILQLKNETTSENGHVTLVCEAEGEPVPEITWKRAIDG
FT                   VMFSEGDKSPDGRIEVKGQHGRSSLHIRDVKLSDSGRYDCEAASRIGGHQRSMHLDIEY
FT                   APKFVSNQTMYYSWEGNPINISCDVTANPPASIHWRREKLLLPAKNTTHLKTHSVGRKM
FT                   ILEIAPTSDNDFGRYNCTATNRIGTRFQEYILELADVPSSPHGVKIIELSQTTAKISFN
FT                   KPESHGGVPIHHYQVDVKEVASETWKIVRSHGVQTMVVLSSLEPNTTYEIRVAAVNGKG
FT                   QGDYSKIEIFQTLPVREPSPPSIHGQPSSGKSFKISITKQDDGGAPILEYIVKYRSKDK
FT                   EDQWLEKKVQGNKDHIILEHLQWTMGYEVQITAANRLGYSEPTVYEFSMPPKPNIIKDN
FT                   CCEANKGENGGQSWHLNAVGFTFVITMSLSCLF"
FT   sig_peptide     100..156
FT                   /gene="RNCAM"
FT   mat_peptide     157..2280
FT                   /gene="RNCAM"
FT                   /product="Rb-8 neural cell adhesion molecule short form"
XX
SQ   Sequence 3485 BP; 1151 A; 710 C; 720 G; 904 T; 0 other;
     ggcggcgggc tagcagaggc ggccgtggca gcggaaggtt ctctctccgg ggctggactt        60
     aataactttg gaactgtccg ccggtgtcac gtcctgaaca tgagcctcct cctctccttc       120
     tacctgctcg ggttgcttgt caggagcggg caagctcttc ttcaagtgac aatttcactt       180
     agcaaagtag agcttagtgt gggtgagtct aaattcttca catgtacagc cattggtgag       240
     cctgagagta tcgactggta taaccctcaa ggagagaaga tcatttcaac gcagagggtt       300
     atgctacaga aggagggtgt caggtcacga ctcaccatct acaatgcaaa catagaagat       360
     gcagggatat atcgctgtca agcgacagat gccaaaggac agacacaaga agctacagta       420
     gttttggaaa tttaccaaaa actcaccttc agagaagtgg tgtcccctca agagttcaag       480
     caaggggagg atgcagaagt ggtttgcaga gtgagcagtt ccccagcccc tgcggtcagc       540
     tggttgtacc acaatgagga agtcaccacc atccccgaca atcggtttgc agtgcttgca       600
     aacaataatt tgcagatcct caatatcaat aaaagtgatg aaggtatata cagatgtgaa       660
     ggaagagtgg aggcgagggg agagattgac ttccgggata tcattgttat tgttaacgtt       720
     ccaccagcaa tcatgatgcc ccagaagtcc ttcaatgcta cagcagagag aggagaagag       780
     atgaccttaa catgcaaggc ctcgggctcc ccagatccaa ccatctcttg gttcaggaac       840
     ggcaaactca ttgaagaaaa tgaaaagtat attttaaagg gcagtaatac agagctcact       900
     gtcaggaaca taatcaataa agacgggggc tcttatgtct gcaaagcaac aaacaaggca       960
     ggagaagatc aaaagcaggc cttccttcaa gtctttgtac agcctcatat attacaactt      1020
     aaaaatgaga caacatctga gaatggtcat gtcacactcg tatgtgaagc agaaggggag      1080
     cctgttccag aaatcacatg gaaaagagcc atagatggag tcatgttttc tgaaggtgat      1140
     aagagtccgg atggccgcat cgaagttaaa gggcagcatg gacgctcttc actgcacatt      1200
     agagatgtga agttgtcaga ttcggggaga tatgactgtg aggccgctag tcggattggt      1260
     gggcaccaga ggagcatgca cctggacatc gaatatgctc ctaagtttgt ttcaaatcag      1320
     acaatgtatt actcttggga aggaaatcca atcaacataa gttgtgatgt gacagcaaac      1380
     ccacctgcgt caatccactg gagaagagag aaactgctct taccagctaa gaatacgact      1440
     catttaaaaa ctcacagtgt aggaagaaag atgatactcg agattgcccc cacatcagac      1500
     aatgactttg gacgatataa ctgcacagct actaaccgta taggcacaag atttcaggaa      1560
     tatattcttg aattagcaga tgtcccctct agtccccatg gagtgaagat tatagagctg      1620
     tcacagacca cagccaagat ctctttcaat aaacccgaat cccatggagg tgtgcctatt      1680
     catcactatc aagtggatgt caaagaagtg gcatcagaaa cctggaaaat agtacgctcc      1740
     catggagttc aaacgatggt tgttttgagc agtctggaac caaatacgac ttacgaaatt      1800
     agggttgcag cagtgaatgg caaaggtcaa ggagactaca gtaaaataga aatattccag      1860
     acactgccag tccgtgagcc aagtccccct tccatacatg gacagccaag cagtggcaag      1920
     agttttaaaa tcagcatcac caagcaagat gatggagggg ctcctatttt agaatacatt      1980
     gtaaaataca gaagtaaaga caaggaagat cagtggctag agaagaaggt acagggaaat      2040
     aaagaccaca ttatcttgga gcatctgcag tggacaatgg gctacgaagt gcaaatcaca      2100
     gctgccaaca gactgggata ttctgagcct actgtatatg agttcagcat gcccccaaaa      2160
     cccaacatta ttaaagataa ttgctgtgaa gcgaataaag gtgaaaatgg aggccagtca      2220
     tggcatctga atgctgttgg gtttactttt gtaataacca tgagtttgtc ttgtttgttt      2280
     tagtgttcta tgttctatgg tactccctga tcagagataa aagagtaggt acaggctaat      2340
     caaaaatttt aatcaacatt ttcagtccag ttcaatttat gtttacacaa ttcgccttcc      2400
     ccctgaattc agtactttct ctaattttat ctgtgtaatt tggaagaaag caatgcagaa      2460
     agaaattaca gaagaagttt tttcttgcaa atactttttc agtaacaata tgtttgactc      2520
     ccaatccatt actttgcaaa gtagactttg ttacattgaa tttaatttct atagtgggtc      2580
     ttgctttcat ttcagtatgc aaatatcatt caacatccat cccataagta taaaacaagt      2640
     aaatttttgt tttacaaaat tgtgaatcac ttctaacaag tctttaatac tgttaaaaga      2700
     aaatttctgg ttttgtgaac atttctcgat tttatagtgc ctaccattta tataaatcat      2760
     aagcttgata ccctattata tcaggtacat ctatttcttg ttctgctttc tgtagtttga      2820
     gataaacact ctctgaagaa acaaaatata atcaaatttc ctttcatttt tgaacatcca      2880
     attaacattt tcttaagtga atatgcgtct ctcccattat cgataataag taaacttaat      2940
     ctcagtacat ttaaatgcta ctaagttcag tatgttcaca ggaacctttg gccagtggtg      3000
     cagatctaaa tctgttccag gtatctattt cattttcact actgctgaca ttccctctct      3060
     tttgcaagca tcagaataca aagtggccat tttaggcatt actttaaagg aggtggaaat      3120
     gagagggaaa caagaggctg ctgtattcag ataaaaacaa aacaaaacaa aacaaagcaa      3180
     agcaaaacaa aaccaaagta aaacacacaa acccaaactg aaaccaacca accaaacaaa      3240
     caaacaaaaa actcaattgg aaaaaataca ggaaaaattg tatgtctttc tcaagtttcg      3300
     gttattcgtt aatgagagga atgtgctgtt agctttgaat cacatcctat gaaataatga      3360
     ttagtattta aggcagttaa gaaaccacac atgcaccaac agacacacac acacacacac      3420
     caacactcac acacatgcac atacaaccac accatataga caaatataac catctttact      3480
     tgctc                                                                  3485
//


spacer
spacer