Dbfetch

ID   AF012129; SV 1; linear; mRNA; STD; MUS; 1691 BP.
XX
AC   AF012129;
XX
DT   21-NOV-1997 (Rel. 53, Created)
DT   23-SEP-2008 (Rel. 97, Last updated, Version 6)
XX
DE   Mus musculus putative DNA methyltransferase (Dnmt2) mRNA, complete cds.
XX
KW   .
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha; Muroidea; Muridae;
OC   Murinae; Mus; Mus.
XX
RN   [1]
RP   1-1691
RX   DOI; 10.1093/hmg/7.2.279.
RX   PUBMED; 9425235.
RA   Yoder J.A., Bestor T.H.;
RT   "A candidate mammalian DNA methyltransferase related to pmt1p of fission
RT   yeast";
RL   Hum. Mol. Genet. 7(2):279-284(1998).
XX
RN   [2]
RP   1-1691
RA   Yoder J.A., Bestor T.H.;
RT   ;
RL   Submitted (01-JUL-1997) to the INSDC.
RL   Genetics and Development, Columbia University, 701 W. 168th St., New York,
RL   NY 10032, USA
XX
RN   [3]
RC   Sequence update by submitter
RP   1-1691
RA   Yoder J.A., Bestor T.H.;
RT   ;
RL   Submitted (21-NOV-1997) to the INSDC.
RL   Genetics and Development, Columbia University, 701 W. 168th St., New York,
RL   NY 10032, USA
XX
DR   MD5; c1ebe1fd2a46e899c0c892dd9d1ad9cc.
DR   Ensembl-Gn; ENSMUSG00000026723; mus_musculus.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0025356; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_AJ_G0025333; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AKRJ_G0025302; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_BALBcJ_G0025329; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_C3HHeJ_G0025089; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0025771; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_CASTEiJ_G0024552; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CBAJ_G0025068; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_DBA2J_G0025200; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_FVBNJ_G0025162; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_LPJ_G0025286; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0025194; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0025829; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0024303; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_WSBEiJ_G0024622; mus_musculus_wsbeij.
DR   Ensembl-Tr; ENSMUST00000124488; mus_musculus.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0052647; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_AJ_T0052653; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AKRJ_T0052602; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_BALBcJ_T0052600; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_C3HHeJ_T0052333; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0053085; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_CASTEiJ_T0052491; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CBAJ_T0052279; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_DBA2J_T0052380; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_FVBNJ_T0052340; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_LPJ_T0052499; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0052333; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0053219; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0052103; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_WSBEiJ_T0051614; mus_musculus_wsbeij.
DR   EuropePMC; PMC18391; 10518555.
DR   EuropePMC; PMC2394268; 12865923.
XX
CC   On Nov 22, 1997 this sequence version replaced gi:2627432.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1691
FT                   /organism="Mus musculus"
FT                   /mol_type="mRNA"
FT                   /db_xref="taxon:10090"
FT   CDS             20..1267
FT                   /codon_start=1
FT                   /gene="Dnmt2"
FT                   /product="putative DNA methyltransferase"
FT                   /db_xref="GOA:O55055"
FT                   /db_xref="InterPro:IPR001525"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR031303"
FT                   /db_xref="MGI:MGI:1274787"
FT                   /db_xref="UniProtKB/Swiss-Prot:O55055"
FT                   /protein_id="AAC53529.1"
FT                   /translation="MEPLRVLELYSGIGGMHHALRESHIPAHVVAAIDVNTVANEVYKH
FT                   NFPHTHLLSKTIEGISLEDFDKLSFNMILMSPPCQPFTRIGLQGDMTDPRTTSFLYILD
FT                   ILPRLQKLPKYILLENVKGFEVSSTRGLLIQTIEACGFQYQEFLLSPSSLGIPNSRLRY
FT                   FLIAKLQSEPFPFQAPGQILMEFPKIVTVEPQKYAVVEESQPRVQRTGPRICAESSSTQ
FT                   SSGKDTILFKLETVEERDRKHQQDSDLSVQMLKDFLEDGDTDEYLLPPKLLLRYALLLD
FT                   IVKPTSRRSMCFTKGYGSYIEGTGSVLQAAEDAQIENIYKSLPDLPPEEKIAKLSMLKL
FT                   RYFTPKEIANLQGFPPEFGFPEKTTVKQRYRLLGNSLNVHVVAKLLTVLCEGFGNASES
FT                   CHKMPLILDSNSKILS"
XX
SQ   Sequence 1691 BP; 501 A; 350 C; 333 G; 507 T; 0 other;
     cggtcgcggt tgcgagagga tggaacctct gcgtgtcctg gagctgtaca gtggcattgg        60
     tggcatgcac cacgcgctgc gagaaagtca tatccctgca catgtggtgg ctgctattga       120
     tgtgaatact gttgctaatg aagtatacaa gcataatttt cctcatactc acttactgtc       180
     aaagacaatt gaaggtattt cactggaaga ctttgacaag ctatctttca atatgatttt       240
     aatgagccct ccatgccagc cattcacaag aattggccta cagggggata tgaccgatcc       300
     aaggacaact agcttcttgt atattctaga tattctccca agattacaaa aattacccaa       360
     gtatattctc ttagaaaatg tcaaaggttt tgaagtatct tctacaagag ggctgctgat       420
     acaaacaata gaagcctgtg gctttcagta tcaagagttt ctattgtctc cttcttctct       480
     aggcattcca aactcgaggc tccgatattt tctcattgca aagcttcagt cagagccttt       540
     ccccttccag gcccctggac agatactgat ggagtttcct aaaattgtaa ctgttgagcc       600
     acaaaaatat gcagtagttg aagaaagtca gccaagagtg cagagaactg gaccacgtat       660
     ctgtgctgag agcagcagca cacagagttc tggaaaagat accattctct ttaagcttga       720
     gactgtagaa gaaagggaca ggaaacatca acaagacagt gacctctctg tgcagatgct       780
     gaaagacttc cttgaagatg gcgacacaga tgagtacctt ttaccaccca agttattgct       840
     gcgatacgct ctcttactag atatcgtgaa gcccacgtcc agaaggtcca tgtgctttac       900
     gaaagggtat gggagttaca tagaggggac aggctccgtg ttacaggctg cagaggatgc       960
     gcagattgag aatatctaca aatctcttcc tgatttgcca ccagaagaaa agatagctaa      1020
     attgtcaatg cttaaactgc gatatttcac accgaaagaa attgcaaatc tccagggatt      1080
     tcctccagaa tttgggtttc ctgagaagac aacagtgaaa cagcgttacc ggctgcttgg      1140
     caatagcctc aacgtgcatg tggtagcaaa actcctcaca gtcctgtgtg aaggatttgg      1200
     aaatgcctct gagagctgtc acaagatgcc gctaattcta gatagtaatt ccaagattct      1260
     atcttgaatg aattcttata gagttcagct aaattctttg aatagcattt tcctgggtaa      1320
     ttcagcagga acttaaatgt gtacatccaa ttgtccctca catttatgtc actgtatcat      1380
     ccaattgtcc ctcacattta tgtcactgta tcatccaatt gtccctcaca tttatgtcac      1440
     tgtatcatcc aattgtccct tacatttatg tcactgtatc atccaattgt cccttacatt      1500
     tatgtcactg gatttgataa cttcacattg ctggttttgc tttatggaca aatattttta      1560
     caaagctttt aaacttgtgt attaaatatc ttttatatta tgttataaac aaatttaaga      1620
     atgcttgaat tttatatgta tattagtact ttataaagta tgacatgaat aatataatga      1680
     tccttagaaa a                                                           1691
//