spacer

EBI Dbfetch

ID   AF011360; SV 1; linear; mRNA; STD; MUS; 2113 BP.
XX
AC   AF011360;
XX
DT   08-JAN-1998 (Rel. 54, Created)
DT   07-OCT-2008 (Rel. 97, Last updated, Version 4)
XX
DE   Mus musculus regulator of G-protein signaling 7 (RGS7) mRNA, complete cds.
XX
KW   .
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi; Muroidea;
OC   Muridae; Murinae; Mus; Mus.
XX
RN   [1]
RP   1-2113
RX   DOI; 10.1016/S0896-6273(00)80437-7.
RX   PUBMED; 9459445.
RA   He W., Cowan C.W., Wensel T.G.;
RT   "RGS9, a GTPase accelerator for phototransduction";
RL   Neuron 20(1):95-102(1998).
XX
RN   [2]
RP   1-2113
RA   He W., Cowan C.W., Wensel T.G.;
RT   ;
RL   Submitted (30-JUN-1997) to the INSDC.
RL   Verna and Marrs McLean Department of Biochemistry, Baylor College of
RL   Medicine, One Baylor Plaza, Houston, TX 77030, USA
XX
DR   MD5; e889775224db68b8362fc9cf58f76d21.
DR   Ensembl-Gn; ENSMUSG00000026527; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000027812; mus_musculus.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..2113
FT                   /organism="Mus musculus"
FT                   /mol_type="mRNA"
FT                   /db_xref="taxon:10090"
FT   CDS             177..1586
FT                   /codon_start=1
FT                   /gene="RGS7"
FT                   /product="regulator of G-protein signaling 7"
FT                   /note="GTPase accelerating protein for heterotrimeric
FT                   G-proteins"
FT                   /db_xref="GOA:O54829"
FT                   /db_xref="InterPro:IPR000342"
FT                   /db_xref="InterPro:IPR000591"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR015898"
FT                   /db_xref="InterPro:IPR016137"
FT                   /db_xref="InterPro:IPR024066"
FT                   /db_xref="MGI:MGI:1346089"
FT                   /db_xref="UniProtKB/Swiss-Prot:O54829"
FT                   /protein_id="AAC99483.1"
FT                   /translation="MAQGNNYGQTSNGVADESPNMLVYRKMEDVIARMQDEKNGIPIRT
FT                   VKSFLSKIPSVFSGSDIVQWLIKNLTIEDPVEALHLGTLMAAHGYFFPISDHVLTLKDD
FT                   GTFYRFQTPYFWPSNCWEPENTDYAVYLCKRTMQNKARLELADYEAESLARLQRAFARK
FT                   WEFIFMQAEAQAKVDKKRDKIERKILDSQERAFWDVHRPVPGCVNTTEVDIKKSSRMRN
FT                   PHKTRKSVYGLQNDIRSHSPTHTPTPETKPPTEDELHQQIKYWQIQLDRHRLKMSKVAD
FT                   SLLSYTEQYVEYDPFLVPPDPSNPWLSDDTTFWELEASKEPSQQRVKRWGFGMDEALKD
FT                   PVGREQFLKFLESEFSSENLRFWLAVEDLKRRPIREVPSRVQEIWQEFLAPGAPSAINL
FT                   DSKSYDKTTQNVKEPGRYTFEDAQEHIYKLMKSDSYPRFIRSSAYQELLQAKRKGKTLT
FT                   SKSLTSLVQSY"
XX
SQ   Sequence 2113 BP; 622 A; 501 C; 489 G; 501 T; 0 other;
     tggcggtggc ctgagcagcg cgagtgtgat gaggctgccc tgcctcgcag ctccgctcgc        60
     agccagctga cagcgcctgc cctcagcaca cccggagggg agccgcgggg ccgtgacctt       120
     ggccgaggag ggcagattga tcatccttgt atctgagcta ccaagttctg ggtgaaatgg       180
     ctcagggaaa taattatgga cagaccagca acggggtggc ggacgaatca cccaacatgc       240
     tggtgtacag aaagatggaa gatgtcatag cacgtatgca agacgagaaa aacggaattc       300
     ccatccgtac cgtcaaaagc ttcctttcca agatccccag tgtcttctcc gggtcagaca       360
     ttgttcaatg gttaataaag aacttaacta tagaagatcc agtggaggct ctccatttgg       420
     gaacgctaat ggctgcccat ggctacttct ttcccatctc agatcatgtc ctcacactca       480
     aggatgacgg caccttctac cggtttcaga caccctattt ttggccgtca aattgttggg       540
     agccagaaaa cacagactat gctgtttacc tctgcaagag aacaatgcaa aacaaggcaa       600
     ggctagagct agcagattat gaagccgaga gcctggccag gctgcagaga gcatttgccc       660
     ggaagtggga gttcattttt atgcaagcag aagcacaagc taaagtggac aagaagagag       720
     acaaaattga aaggaagatc ctcgatagtc aagagagagc attctgggat gtccacaggc       780
     ctgtgcctgg atgtgtaaat actacagaag tggacattaa gaagtcatcc cggatgagaa       840
     acccacacaa aacacgaaag tctgtctatg gtttacaaaa tgacatccga agtcacagtc       900
     ccacccacac acctacacca gaaaccaagc ctcctacaga agatgagctg caccaacaga       960
     taaaatactg gcaaatacag ttagatagac atcggttaaa aatgtcaaaa gttgctgata      1020
     gtctactaag ctatacggaa cagtatgtag aatatgaccc atttcttgtg ccgcctgacc      1080
     cttccaatcc atggctttca gatgatacga ctttctggga acttgaagca agcaaagaac      1140
     caagtcaaca gagggtaaaa cgatggggtt ttggtatgga tgaggcattg aaagacccag      1200
     ttgggagaga gcagttcctt aagtttctag aatcagaatt cagctcagag aacttaaggt      1260
     tctggttggc agtggaggac ctgaagagaa ggcctatccg agaggtcccc tcgagagtgc      1320
     aggaaatatg gcaagaattt ctggctcctg gggcccccag tgccattaac ttggattcta      1380
     agagttatga caagaccaca cagaatgtga aggaaccagg acgatacaca tttgaagatg      1440
     ctcaggagca tatttacaag ctgatgaaga gcgactccta cccccgcttt ataagatcta      1500
     gtgcctacca ggaacttcta caggcaaaga gaaagggaaa aactctcaca tccaagagct      1560
     taacaagcct tgttcagtct tactagaagg accgtctttg tcacatgagt gctgaacgga      1620
     gccatcgccc ataccttgta gcccatcgct gttacctgga gccaaggacg ttagaccaag      1680
     atgttgcatg aacaaaggac tggaattgtt cttttctgtg tgcacataaa gtcatcacac      1740
     ttgccaaggg acgctgtcat ttcattgcct tcatcttcat gtgtcgtctg cttccctctc      1800
     tcctcgtgct aagctggatc cgtgtccttt tctttttaac gagttcaagt gaacgaaaac      1860
     ttatttcccc cccttcctct ccttttcttg aagcttctgc tagatgaaaa ttcactgaaa      1920
     attcagtcag tcacaaactg gaagaattgt aaaagaaaaa aaaagtatat atcactaagt      1980
     acacacatgg cttcacactt attaactaat aaattggcac agaaggtgtc gtttcaccct      2040
     tgtatccaca gtctgaagca agcacccatt ttcatctgtt ctccggacat tgtctgttcc      2100
     tgtttcttgc aca                                                         2113
//


spacer
spacer