Dbfetch

ID   AF008649; SV 1; linear; mRNA; STD; MUS; 3118 BP.
XX
AC   AF008649;
XX
DT   05-NOV-2000 (Rel. 65, Created)
DT   07-OCT-2008 (Rel. 97, Last updated, Version 6)
XX
DE   Mus musculus GABA-B receptor (GABA-B-R) mRNA, complete cds.
XX
KW   .
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha; Muroidea; Muridae;
OC   Murinae; Mus; Mus.
XX
RN   [1]
RP   1-3118
RX   PUBMED; 11306808.
RA   Lamp K., Humeny A., Nikolic Z., Imai K., Adamski J., Schiebel K.,
RA   Becker C.-M.;
RT   "The murine GABA(B) receptor 1: cDNA cloning, tissue distribution,
RT   structure of the Gabbr1 gene, and mapping to chromosome 17";
RL   Cytogenet. Cell Genet. 92(1-2):116-121(2001).
XX
RN   [2]
RP   1-3118
RA   Humeny A., Lamp K., Nikolic Z., Becker C.-M.;
RT   ;
RL   Submitted (17-JUN-1997) to the INSDC.
RL   Biochemistry, University Erlangen-Nuremberg, Fahrstr. 17, Erlangen 91054,
RL   Germany
XX
DR   MD5; 51ab9145f6b53e74f799876d61c777dc.
DR   Ensembl-Gn; ENSMUSG00000024462; mus_musculus.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0023695; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_AJ_G0023653; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AKRJ_G0023624; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_BALBcJ_G0023660; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_C3HHeJ_G0023422; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0024098; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_CASTEiJ_G0022907; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CBAJ_G0023399; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_DBA2J_G0023524; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_FVBNJ_G0023497; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_LPJ_G0023602; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0023520; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0024143; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0022659; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_WSBEiJ_G0022974; mus_musculus_wsbeij.
DR   Ensembl-Tr; ENSMUST00000025338; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000172792; mus_musculus.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0047663; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_AJ_T0047643; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AKRJ_T0047604; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_BALBcJ_T0047610; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_C3HHeJ_T0047342; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0048093; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_CASTEiJ_T0047404; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CBAJ_T0047276; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_DBA2J_T0047375; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_FVBNJ_T0047343; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_LPJ_T0047477; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0047351; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0048188; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0046991; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_WSBEiJ_T0046665; mus_musculus_wsbeij.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..3118
FT                   /organism="Mus musculus"
FT                   /mol_type="mRNA"
FT                   /db_xref="taxon:10090"
FT   CDS             209..3091
FT                   /codon_start=1
FT                   /gene="GABA-B-R"
FT                   /product="GABA-B receptor"
FT                   /note="G protein-coupled inhibitory neurotransmitter
FT                   receptor"
FT                   /db_xref="GOA:Q9WV18"
FT                   /db_xref="InterPro:IPR000436"
FT                   /db_xref="InterPro:IPR001828"
FT                   /db_xref="InterPro:IPR002455"
FT                   /db_xref="InterPro:IPR002456"
FT                   /db_xref="InterPro:IPR017978"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="InterPro:IPR035976"
FT                   /db_xref="MGI:MGI:1860139"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9WV18"
FT                   /protein_id="AAG29338.1"
FT                   /translation="MLLLLLVPLFLRPLGAGGAQTPNVTSEGCQIIHPPWEGGIRYRGL
FT                   TRDQVKAINFLPVDYEIEYVCRGEREVVGPKVRKCLANGSWTDMDTPSRCVRICSKSYL
FT                   TLENGKVFLTGGDLPALDGARVDFRCDPDFHLVGSSRSICSQGQWSTPKPHCQVNRTPH
FT                   SERRAVYIGALFPMSGGWPGGQACQPAVEMALEDVNSRRDILPDYELKLIHHDSKCDPG
FT                   QATKYLYELLYNDPIKIILMPGCSSVSTLVAEAARMWNLIVLSYGSSSPALSNRQRFPT
FT                   FFRTHPSATLHNPTRVKLFEKWGWKKIATIQQTTEVFTSTLDDLEERVKEAGIEITFRQ
FT                   SFFSDPAVPVKNLKRQDARIIVGLFYETEARKVFCEVYKERLFGKKYVWFLIGWYADNW
FT                   FKTYDPSINCTVEEMTEAVEGHITTEIVMLNPANTRSISNMTSQEFVEKLTKRLKRHPE
FT                   ETGGFQEAPLAYDAIWALALALNKTSGGGGRSGVRLEDFNYNNQTITDQIYRAMNSSSF
FT                   EGVSGHVVFDASGSRMAWTLIEQLQGGSYKKIGYYDSTKDDLSWSKTDKWIGGSPPADQ
FT                   TLVIKTFRFLSQKLFISVSVLSSLGIVLAVVCLSFNIYNSHVRYIQNSQPNLNNLTAVG
FT                   CSLALAAVFPLGLDGYHIGRSQFPFVCQARLWLLGLGFSLGYGSMFTKIWWVHTVFTKK
FT                   EEKKEWRKTLEPWKLYATVGLLVGMDILTLAIWQIVDPLHRTIETFAKEEPKEDIDVSI
FT                   LPQLEHCSSKKMNTWLGIFYGYKGLLLLLGIFLAYETKSVSTEKINDHRAVGMAIYNVP
FT                   VLCLITAPVTMILSSQQDAAFAFASLAIVFSSYITLVVLFVPKMRRLITRGEWQSEAQD
FT                   TMKTGSSTNNNEEEKSRLLEKENRELEKIIAEKEERVSELRHQLQSRQQIRSRRHPPTP
FT                   PDPSGGLPRGPSEPPDRLSCDGSRVHLLYK"
XX
SQ   Sequence 3118 BP; 704 A; 862 C; 883 G; 669 T; 0 other;
     cgtcgccccg gggaaggaga gacgggggtg gggtttgcgg gtagcgatcg cgaaggggag        60
     agaccccggc cgggctggag cctggattcc tgtggaagaa gaacaggggg aggggaagct       120
     ggaggaccgg gagggagaac ggggagccgc ggccgggcct gggcccttga ggcccgggga       180
     gagccgcgga gcgggaccgg ccgccgagat gctgctgctg ctgctggtgc ctctcttcct       240
     ccgccccctg ggcgctggcg gggctcagac ccccaacgtc acctcggaag gttgccagat       300
     tatacatccg ccctgggaag gtggcatcag gtaccgtggc ttgactcgcg accaggtgaa       360
     ggccatcaat ttcctgcctg tggactatga gattgaatat gtgtgccggg gcgaacgcga       420
     ggtggtgggg cccaaggtgc gcaagtgcct ggccaacggc tcctggacgg atatggacac       480
     acccagtcgc tgtgtccgaa tctgctccaa gtcttatttg accctggaaa atgggaaggt       540
     tttcctgacg ggtggggacc tcccagctct ggatggagcc cgggtggatt tccgatgtga       600
     ccccgacttc catctggtgg gcagctcccg gagcatctgt agtcagggcc agtggagcac       660
     ccccaagccc cactgccagg tgaatcgaac gccacactca gaacggcgtg cagtatacat       720
     cggggcgctg tttcccatga gcgggggctg gccggggggc caggcctgcc agcctgcggt       780
     ggagatggcg ctggaggacg ttaacagccg cagagacatc ctgccggact acgagctcaa       840
     gcttatccac cacgacagca agtgcgaccc agggcaagcc accaagtact tgtatgaact       900
     actctacaac gaccccatca agatcatcct catgcccggc tgcagctctg tgtccacact       960
     ggtagccgag gctgcccgga tgtggaacct tattgtgctc tcatatggct ccagctcacc      1020
     agccttgtca aaccgacagc ggtttccaac gttctttcgg acacatccat ccgccacact      1080
     ccacaatccc acccgggtga aactcttcga aaagtggggc tggaagaaga ttgccaccat      1140
     ccagcagact accgaggtct tcacctcaac actggatgac ctggaggagc gagtgaaaga      1200
     ggctgggatt gagatcactt ttcgacagag tttcttctca gatccagctg tgcctgttaa      1260
     aaacctgaag cgtcaagatg ctcgaatcat cgtgggactt ttctatgaga ccgaagcccg      1320
     gaaagttttt tgtgaggtct ataaggaacg gctctttggg aagaagtatg tctggtttct      1380
     catcgggtgg tatgctgaca actggttcaa aacctatgac ccgtcaatca attgtacagt      1440
     agaagagatg actgaggcgg tggagggcca tatcaccacg gagattgtca tgctgaaccc      1500
     tgccaacacc cgaagcattt ccaacatgac atcacaggaa tttgtggaga aactaaccaa      1560
     gcggctgaaa agacaccctg aggagactgg aggcttccag gaggcaccac tggcctatga      1620
     tgctatctgg gccttggctt tggccttgaa caagacctct ggaggaggtg gccgttcagg      1680
     agtgcgcctg gaggacttta actacaacaa ccagaccatt acagaccaaa tctaccgggc      1740
     catgaactcc tcctcctttg agggtgtttc tggccacgtg gtctttgatg ccagcggctc      1800
     ccggatggca tggacgctta tcgagcagct acagggcggc agctacaaga agatcggcta      1860
     ctacgacagc accaaggatg atctttcctg gtccaaaaca gacaagtgga tcggagggtc      1920
     tcccccagcc gaccagacct tggtcatcaa gacattccgt ttcctgtcac agaaactctt      1980
     tatctccgtc tcagttctct ccagcctggg cattgttctt gctgttgtct gtctgtcctt      2040
     taacatctac aactcccacg ttcgttatat ccagaactcc cagcccaacc tgaacaatct      2100
     gactgctgtg ggctgctcac tggcactagc tgctgtcttc ccccttgggc tggatggtta      2160
     ccacataggg agaagccagt tcccatttgt ctgccaggcc cgcctttggc tcttgggctt      2220
     aggctttagt ctgggctatg gctctatgtt caccaagatc tggtgggtcc acacagtctt      2280
     cacaaagaag gaggagaaga aggaatggag gaagacccta gagccttgga aactgtacgc      2340
     cactgtaggc ctgctggtgg gcatggatat cctgactctt gccatctggc agattgtgga      2400
     ccccttgcac cgaaccattg agacttttgc caaggaggaa ccaaaggaag acattgatgt      2460
     ctccattctg ccccagctgg agcactgcag ctccaagaag atgaatacat ggctcggcat      2520
     tttctatggt tacaaagggc tgctgctgct gctgggaatc tttcttgctt atgagaccaa      2580
     aagtgtgtcc actgaaaaga tcaatgacca cagggccgtg ggcatggcta tctacaatgt      2640
     tccggtcctg tgtctcatta ccgctcctgt caccatgatc ctttccagcc agcaggacgc      2700
     agccttcgcc tttgcctctc tggccattgt gttctcttcc tacattactc tggttgtgct      2760
     ctttgtgcct aagatgcgca ggttgatcac tcgaggtgaa tggcagtctg aagcacagga      2820
     cacaatgaaa acaggatcat ccaccaacaa caatgaggaa gagaagtccc gactgttgga      2880
     gaaggaaaac cgtgaattgg aaaagatcat cgccgagaaa gaggagcgtg tctctgaact      2940
     gcgccatcag ctccagtctc ggcagcagat ccgctcccgg cgccaccccc caacaccccc      3000
     agacccctct gggggccttc ccaggggacc ctcagagccc cctgaccggc ttagctgtga      3060
     tgggagtcga gtacatttgc tttacaagtg agggtgtatc gagaaggatc aaagccat        3118
//