spacer

EBI Dbfetch

ID   AF008574; SV 1; linear; mRNA; STD; MUS; 2293 BP.
XX
AC   AF008574;
XX
DT   07-OCT-1997 (Rel. 52, Created)
DT   15-APR-2005 (Rel. 83, Last updated, Version 2)
XX
DE   Mus musculus potassium channel alpha subunit (Kv9.2) mRNA, complete cds.
XX
KW   .
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi; Muroidea;
OC   Muridae; Murinae; Mus; Mus.
XX
RN   [1]
RP   1-2293
RX   DOI; 10.1074/jbc.272.39.24371.
RX   PUBMED; 9305895.
RA   Salinas M., Duprat F., Heurteaux C., Hugnot J.P., Lazdunski M.;
RT   "New modulatory alpha subunits for mammalian Shab K+ channels";
RL   J Biol Chem 272(39):24371-24379(1997).
XX
RN   [2]
RP   1-2293
RA   Salinas M., Duprat F., Heurteaux C., Hugnot J.P., Lazdunski M.;
RT   ;
RL   Submitted (16-JUN-1997) to the INSDC.
RL   CNRS, IPMC, Lucioles, Valbonne Sophia Antipolis 06560, France
XX
DR   MD5; d563ced711f4e5badf7ccf0628a5e1e3.
DR   Ensembl-Gn; ENSMUSG00000050963; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000072868; mus_musculus.
DR   EuropePMC; PMC2394268; 12865923.
DR   RFAM; RF00485; K_chan_RES.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..2293
FT                   /organism="Mus musculus"
FT                   /chromosome="8"
FT                   /map="8q22"
FT                   /mol_type="mRNA"
FT                   /db_xref="taxon:10090"
FT   CDS             268..1701
FT                   /codon_start=1
FT                   /gene="Kv9.2"
FT                   /product="potassium channel alpha subunit"
FT                   /db_xref="GOA:O35174"
FT                   /db_xref="InterPro:IPR000210"
FT                   /db_xref="InterPro:IPR003091"
FT                   /db_xref="InterPro:IPR003131"
FT                   /db_xref="InterPro:IPR003968"
FT                   /db_xref="InterPro:IPR003971"
FT                   /db_xref="InterPro:IPR005821"
FT                   /db_xref="InterPro:IPR011333"
FT                   /db_xref="InterPro:IPR027359"
FT                   /db_xref="InterPro:IPR028325"
FT                   /db_xref="MGI:MGI:1197011"
FT                   /db_xref="UniProtKB/Swiss-Prot:O35174"
FT                   /protein_id="AAB72051.1"
FT                   /translation="MTRQSLWDVSDTDVEDGEIRINVGGFKRRLRSHTLLRFPETRLGR
FT                   LLLCHSREAILELCDDYDDVQREFYFDRNPELFPYVLHFYHTGKLHVMAELCVFSFSQE
FT                   IEYWGINEFFIDSCCSYSYHGRKVEPEQEKWDEQSDQESTTSSFDEILAFYNDASKFDG
FT                   QPLGNFRRQLWLALDNPGYSVLSRVFSVLSILVVLGSIITMCLNSLPDFQIPDSQGNPG
FT                   EDPRFEIVEHFGIAWFTFELVARFAVAPDFLKFFKNALNLIDLMSIVPFYITLVVNLVV
FT                   ESSPTLANLGRVAQVLRLMRIFRILKLARHSTGLRSLGATLKYSYKEVGLLLLYLSVGI
FT                   SIFSVVAYTIEKEENEGLATIPACWWWATVSMTTVGYGDVVPGTTAGKLTASACILAGI
FT                   LVVVLPITLIFNKFSHFYRRQKQLESAMRSCDFGDGMKEVPSVNLRDYYAHKVKSLMAS
FT                   LTNMSRSSPSELSLDDSLH"
XX
SQ   Sequence 2293 BP; 494 A; 616 C; 587 G; 594 T; 2 other;
     gcacgaggcg cactcgcgca ggtgcgagga tgtagatgtg agtgcttgtc tgtgtgcccc        60
     gccaccgggc aggcggggtc caccgtgcgc ctccttcagt ctccggccgc acacaccacc       120
     gcccacatcc gcgcagccag ccaacggcgt ccaccgcggt gatgcttgcc agcaggtcgg       180
     ggaagtttcc cgccggcctc tgccgcgggc tcccgtgcac ccaggtgtag cgcccccgcg       240
     cggcgcgggc gcctgggcat ctccagcatg acccgccaga gcctgtggga tgtgtccgat       300
     accgacgtcg aggatggaga gatccgcatc aatgtgggtg gcttcaagag acggctgcgt       360
     tcccatacgc tgctgcgctt ccctgagaca cgcctgggcc gtctgctcct ctgccactcg       420
     cgagaggcca ttctggaact ctgcgatgac tacgatgacg ttcagcgtga gttctacttc       480
     gaccgtaacc ccgagctctt cccctatgtg ttgcatttct accacaccgg caagcttcac       540
     gtcatggctg agctgtgcgt cttctccttc agccaggaga tcgagtactg gggtatcaat       600
     gagttcttca tcgactcttg ctgcagctat agctatcacg gccgcaaagt ggaacctgag       660
     caggagaaat gggacgagca gagtgaccag gaaagcacca cttcctcctt cgatgagatc       720
     ttggccttct ataatgatgc ttccaagttc gatgggcaac ccctgggcaa cttccgcagg       780
     cagctgtggc tggcgttgga caacccaggc tactcagtcc taagcagggt cttcagtgtc       840
     ctttccatct tggtggtgtt gggctccatc atcaccatgt gcctcaatag cctgccagac       900
     ttccaaatcc ctgatagcca gggtaacccc ggtgaagacc ccaggttcga aattgtggag       960
     cactttggca ttgcttggtt cacatttgag ttggtggcca ggtttgctgt ggcccctgac      1020
     tttcttaagt tcttcaagaa tgctctaaac cttattgatc tcatgtccat tgtcccattt      1080
     tacataactc tagtggtgaa cctggtggtg gagagttctc ctaccttggc taacttgggc      1140
     agggtggctc aagtcctgag gctaatgagg atcttccgaa ttctcaagct ggccagacac      1200
     tccactggcc tccgctcctt gggagccacc ctgaagtaca gctacaagga agtggggttg      1260
     ctcttgctct acctctcagt ggggatttcc atcttctctg tggtggccta caccattgaa      1320
     aaggaggaga acgaaggcct ggccaccatc cctgcctgct ggtggtgggc cactgtcagt      1380
     atgaccacag ttgggtacgg agatgtggtc ccagggacaa cagctgggaa gttgactgcc      1440
     tctgcctgca tcttggcagg catcctggtg gtggtcttgc ccatcacttt gatcttcaat      1500
     aagttctccc atttctatcg gcgccaaaag caacttgaga gtgctatgcg cagctgtgac      1560
     tttggagatg gaatgaaaga ggtcccttcg gtcaatttaa gggactacta tgctcataaa      1620
     gttaagtccc tcatggcaag tctgacaaac atgagtagga gttcacctag tgaactgagt      1680
     ttagatgatt ctctacatta gctggacccc gacttacatt gctgatctgc tgcttgtggt      1740
     tctagcacaa tcagggcaat tttagggctg tggcataaga aatcatccct gccctagagg      1800
     gagagctgca tgggacataa gccctagatt gcttttgcaa tgtttagaga ggtttctttt      1860
     ttcttttgag gatggtgtgt ctaataacat gcctttgcac ctctcagtga agtgacactc      1920
     actggtgttt gcatcatggc aaaaaaaaaa atgttcacct ttctgccaga tgagtatcta      1980
     gaatgccaat ttctctgtcc actgtgtaca gtattctaat gctcatatcc cagcattacc      2040
     tgtgagtgga attgtctgtg ctcctatttc cgaagctgct gtatgggttc cagtgacaac      2100
     acatctgtct atgangtcag caaggatatc gtgagatttg gatcacaacc atgtgaaaat      2160
     aatctcaatt atgtttcccc tgctttcatt tacctttaat accaaaacaa aagatcgcca      2220
     actaagcaca cttgaacaat gcaatctcga gttgtcttct acttggcccg tcctgtgaan      2280
     tgcagaagcc cat                                                         2293
//


spacer
spacer