spacer

EBI Dbfetch

ID   AF007769; SV 1; linear; mRNA; STD; MUS; 5497 BP.
XX
AC   AF007769;
XX
DT   11-SEP-1997 (Rel. 52, Created)
DT   23-SEP-2008 (Rel. 97, Last updated, Version 4)
XX
DE   Mus musculus neuronal apoptosis inhibitory protein (mnaip) mRNA, complete
DE   cds.
XX
KW   .
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi; Muroidea;
OC   Muridae; Murinae; Mus; Mus.
XX
RN   [1]
RP   1-5497
RA   Yaraghi Z., Korneluk R.G., MacKenzie A.E.;
RT   "Cloning and Characterization of the Multiple Copies of the Murine
RT   Homologue of NAIP (neuronal apoptosis inhibitory protein)";
RL   Unpublished.
XX
RN   [2]
RP   1-5497
RA   Yaraghi Z., Korneluk R.G., MacKenzie A.E.;
RT   ;
RL   Submitted (09-JUN-1997) to the INSDC.
RL   Solange Gauthier Karsh Molecular Genetics Laboratory, Children's Hospital
RL   of Eastern Ontario, 401 Smyth, Ottawa, Ontario K1H 8L1, Canada
XX
DR   MD5; 2fff48bb0f0b4f0648b6da0e71827784.
DR   Ensembl-Gn; ENSMUSG00000021640; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000022142; mus_musculus.
DR   EuropePMC; PMC310929; 10958634.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..5497
FT                   /organism="Mus musculus"
FT                   /mol_type="mRNA"
FT                   /db_xref="taxon:10090"
FT   exon            1..206
FT                   /gene="mnaip"
FT                   /number=1
FT   exon            207..777
FT                   /gene="mnaip"
FT                   /number=2
FT   CDS             210..4421
FT                   /codon_start=1
FT                   /gene="mnaip"
FT                   /product="neuronal apoptosis inhibitory protein"
FT                   /note="NAIP"
FT                   /db_xref="GOA:Q9QWK5"
FT                   /db_xref="InterPro:IPR001370"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR007111"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="MGI:MGI:1298223"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9QWK5"
FT                   /protein_id="AAB69223.1"
FT                   /translation="MAEHGESSEDRISEIDYEFLPELSALLGVDAVQLAKSQEEEEHKE
FT                   RMKMKKGFNSQMRSEAKRLKTFETYDTFRSWTPQEMAAAGFYHTGVKLGVQCFCCSLIL
FT                   FGNSLRKLPIERHKKLRPECEFLQGKDVGNIGKYDIRVKSPEKMLRGGKARYHEEEARL
FT                   ESFEDWPFYAHGTSPRVLSAAGFVFTGKRDTVQCFSCGGSLGNWEEGDDPWKEHAKWFP
FT                   KCEFLQSKKSSEEIAQYIQGYEGFVHVTGEHFVNSWVRRELPMVSAYCNDSVFANEELR
FT                   MDTFKDWPHESPVAVDALVRAGLFYTGKKGIVQCFSCGGCMEKCTEGDDPIQEHNKFFP
FT                   NCIFLQTPKSSAEVIPALLSHCALPEAMETTSESNHDDPAAVHSTVVGLGRSEAQWFQE
FT                   ARSLSEQLRDNYTKATFRHMNLPEVCSSLGTDHLIGCDVSIISKHISQPVQGALTIPEV
FT                   FSNLSSVMCVEGETGSGKTTFLKRIAFLWASGCCPLLYRFQLVFYLSLSSITPDQGLAN
FT                   IICAQLLGAGGCISEVCLSSIIQQLQHQVLFLLDDYSGLASLPQALHTLITKNYLSRTC
FT                   LLIAVHTNRVRGIRSYLDTSLEIKEFPLSNTVYILKKFFSHNIKRLLEFMVYFGQNEDL
FT                   QGIHKTPLFVAAVCTDWFENPSDQPFQDMALFKSYMQYLSLKHKGAAKPLQATVSSCGQ
FT                   LALTGLFSSCFEFNSDDLAEAGVDEDEELTTCLMSKFTAQRLRPVYRFLGPLFQEFLAA
FT                   MRLTELLSSDRQEDQDLGLYYLRQINSPLKALTTYNNFLKYVFSHPSSKAGPTVVSHLL
FT                   HLVDETELLENTYKNEDYVNHPPGTSRIMKGLKELWLLSPEYYSSFVSEHLLRIALNFA
FT                   YESNTVAECSPFILQFLRGRTLALKVLNLQYFRDHPESLLLVKSLEVSINGNKVPKVVD
FT                   YSVMEKSFETLQPPTIDQDYASAFEQMKEHEKNLSENEETIKSIKNIFPLQPPKISSGY
FT                   WKLSPKPCKIPRLEVGVTNMGPADQALLQVLMEVFSASQSIEFRLSDSSGFLESIRPAL
FT                   ELSKASVTKCSMSRLELSRAEQELLLTLPALQSLEVSETNQLPDQLFHNLHKFLGLKEL
FT                   CVRLDGKPDVLSVLPGEFPNLHHMEKLSIRTSTESDLSKLVKLIQNSPNLHVFHLKCDF
FT                   LSNCDSLMAVLASCKKLREIEFSGRCFEAMPFVNILPNFISLKILNLISQQFPDKETSE
FT                   KFAQALGSLRNLEELLVPTGDGIHQVAKLIVRQCLQLPCLRVLAFHYILDNDSVIEIAR
FT                   VATSGGFQKLEKLDLSMNHKITEEGYRNFFQALDNLPNLQNLNICRHIPECIQVQATTV
FT                   KALGQCVSRLPSLTRLHMLSWLLDEEDMKVINDVKERHPQSKRLIIFWKWIVPFSPVVL
FT                   E"
FT   exon            778..877
FT                   /gene="mnaip"
FT                   /number=3
FT   exon            878..959
FT                   /gene="mnaip"
FT                   /number=4
FT   exon            960..1012
FT                   /gene="mnaip"
FT                   /number=5
FT   exon            3892..4056
FT                   /gene="mnaip"
FT                   /number=14
FT   exon            4097..5497
FT                   /gene="mnaip"
FT                   /number=15
XX
SQ   Sequence 5497 BP; 1551 A; 1240 C; 1271 G; 1435 T; 0 other;
     cctctcctca cagctcgtgc ctgtcaccct ggatgtcact gggatgctgg gcgaggaagc        60
     catggagact ccttctccct tgggacatca ggtctcggtt tgtaagcaga ctttagttcc       120
     tgttagagag acacaaagtt ctgatatggg aaatctcatt gcaggaaacc acctgaggaa       180
     gaagcaggag cctgactgaa ctgaagaaaa tggctgagca tggggagtcc tccgaggatc       240
     ggatttctga gattgattat gaatttctcc ctgagctctc tgctcttctc ggggtggatg       300
     cagttcagct ggcaaagagc caagaagaag aagagcataa agaacggatg aaaatgaaga       360
     aaggttttaa ctcacagatg cgcagtgaag ccaaacgact aaagaccttt gagacctatg       420
     acacgttcag atcatggacg ccacaggaga tggcagctgc tgggttttac cacacagggg       480
     tgaaacttgg ggttcagtgc ttttgctgta gcttgatcct ctttggcaat agcctcagga       540
     agcttcccat agagagacac aagaaattac gtccagaatg tgagttcctt cagggaaaag       600
     atgttggtaa cattggcaag tatgacatcc gggtgaagag tccagagaag atgctgagag       660
     gtggcaaagc caggtaccat gaagaggagg ccagactgga gtcctttgag gactggccat       720
     tttatgccca tgggacatca ccacgtgtac tctcagcagc tggctttgtc tttacaggta       780
     aaagggacac tgtgcagtgt ttttcctgtg gcggaagctt gggcaactgg gaagaaggag       840
     atgacccctg gaaggagcat gccaagtggt tccccaaatg tgaatttctt caaagtaaga       900
     aatcttcaga ggaaattgcc cagtatatcc aaggctatga gggatttgtt catgtaacgg       960
     gagaacattt tgtgaattcc tgggtcagaa gagaattacc tatggtatca gcttactgca      1020
     acgacagcgt cttcgctaat gaagaactaa ggatggacac gtttaaggac tggccccacg      1080
     aatcacctgt ggctgttgat gctttggtca gagctggcct tttctacaca ggcaaaaagg      1140
     gcattgtcca gtgtttttcc tgtggaggat gtatggagaa gtgcacagaa ggtgacgacc      1200
     caatacaaga gcacaacaag ttttttccca actgtatatt tctccaaacc ccgaagtcct      1260
     ctgcagaagt gattccagcc cttctgagcc actgtgcact tccagaagcc atggaaacca      1320
     caagtgaaag caaccacgat gatccagcag cagttcattc tacagtggtg ggcttgggta      1380
     ggagtgaagc ccagtggttt caagaggcca ggagtctgag tgagcagcta agagacaact      1440
     acactaaagc cacttttcgc cacatgaact tgccagaagt gtgctccagc cttggcactg      1500
     accacttgat cggctgcgat gtgtccatca tttcaaagca catcagccag cctgtgcaag      1560
     gggccctgac gatccctgag gtcttctcca atctcagctc tgtcatgtgt gtggaggggg      1620
     aaactggcag tggaaagaca accttcctga agaggatagc ttttctctgg gcatcaggat      1680
     gctgcccctt gttgtacagg ttccagctgg tcttctacct ctcccttagt tccatcacac      1740
     cagaccaggg actggccaac atcatctgtg cccaactcct aggggcagga ggctgcatta      1800
     gtgaagtgtg tctgagcagc atcatccagc agttacaaca ccaggtgctg ttcctgttgg      1860
     atgactacag tgggctggcc tcactccccc aagccctaca tacactgatt acaaaaaact      1920
     acttgtcacg gacctgctta ttgatcgctg tgcatacaaa cagggtcagg ggcatccgct      1980
     catacctaga tacgagtcta gagatcaaag agtttccctt gtccaatact gtctatatat      2040
     taaagaagtt cttctcccat aatataaaac gtctactaga gtttatggtt tattttggac      2100
     agaatgaaga tttacaggga attcacaaga cccccctctt cgtggcagca gtatgtactg      2160
     actggtttga aaatccatct gaccagccct ttcaggatat ggcacttttc aagtcctaca      2220
     tgcaatacct gtccttaaag cacaaaggtg cagctaagcc tctccaagcc accgtgtcct      2280
     catgtgggca gctggccttg acagggcttt tctcatcatg ctttgagttc aatagtgatg      2340
     acctggcaga ggcaggagtt gatgaagatg aagagctcac cacctgcttg atgagcaaat      2400
     tcaccgccca gagactgagg ccagtctacc ggtttttagg tccgctgttc caggagtttc      2460
     ttgctgccat gagactgact gaacttctga gttcagatag gcaggaagac caagatctgg      2520
     gactttatta tttgagacaa attaactcac ccttgaaggc tttgaccacc tacaacaatt      2580
     ttttgaagta tgtctttagc catccgtcat caaaggcagg gccaacagtt gtatctcatt      2640
     tgcttcactt ggtggatgag acagagttgc tggagaatac ctataaaaat gaggattatg      2700
     taaatcaccc tccaggaact tcccgaataa tgaagggact taaggaactg tggctgttat      2760
     ctcctgaata ttactcttca tttgtttcag aacatttatt gcgcattgct ctaaactttg      2820
     cttatgaaag caacactgtt gctgaatgtt ctccatttat tttgcagttc cttagaggga      2880
     gaacactggc tttgaaagta ctgaatttac aatactttag ggaccaccca gaaagcctgt      2940
     tactggtgaa gagtttagaa gtctcgataa atggaaataa agtgccaaaa gttgtagatt      3000
     attcagtcat ggaaaaaagt tttgaaacat tacagccacc aactatagat caggactatg      3060
     catccgcctt tgaacaaatg aaggaacatg aaaaaaattt atctgaaaat gaagagacca      3120
     taaagagtat taagaacatc ttccccttac agccacctaa aataagctct ggctattgga      3180
     aactgtcccc caagccatgc aagatcccta ggctggaagt tggagtgacc aacatgggtc      3240
     cagcagatca agcactgctc caggtcctca tggaagtctt ctcagcttca cagagtattg      3300
     agttccgttt atccgacagc agtggcttcc ttgaaagcat ccgcccagct ctggagctga      3360
     gtaaggcctc tgtcaccaag tgttccatgt ccaggctgga gctcagcaga gcagaacagg      3420
     agttgcttct caccctgcct gccctgcagt ctctcgaggt ctcagagaca aaccagttac      3480
     cagatcagct cttccataac ttgcacaagt tcctgggcct gaaagaactg tgtgtgagac      3540
     tagatggcaa gccggatgtg ctctcagtcc ttcctggaga gttcccaaac ctccatcaca      3600
     tggagaagtt atccatcaga acctccacgg agtctgacct ctccaaacta gttaaattga      3660
     ttcagaactc tccaaatctc catgttttcc atctgaaatg tgatttcctt tcgaattgtg      3720
     actctctcat ggctgtgctt gcttcctgca agaaactcag agagattgag ttttctggac      3780
     gatgctttga agccatgccc tttgttaaca ttttgccaaa ttttatttct ctgaagatat      3840
     taaatcttat aagccaacaa ttcccagata aggaaacatc agaaaagttt gcccaggctc      3900
     tgggttctct caggaacctg gaggaactgc tcgttcccac tggagacggg attcaccaag      3960
     tggccaaatt gattgtccgg cagtgtctgc agcttccgtg tctccgagtt cttgcctttc      4020
     actacatctt ggacaatgac agtgtgattg aaattgccag ggtggcaacc agtggaggtt      4080
     tccagaaact cgagaagtta gatctttcca tgaatcacaa gattaccgag gaaggatata      4140
     gaaatttctt tcaagccctg gacaacctgc caaacttgca gaatctgaac atctgcagac      4200
     atatcccaga atgcattcaa gttcaggcca ccactgtcaa ggctctgggt caatgtgtgt      4260
     cccgactgcc cagcctcact aggctgcaca tgctcagttg gctcctggat gaagaggaca      4320
     tgaaagtgat taatgatgtg aaggaaagac acccccagtc caaacgcttg attatcttct      4380
     ggaaatggat agtcccgttc tctcctgttg tcctggagta aaggatgctc ctgaagacta      4440
     ctgatagttc agaataccag atttcctaaa acactttact ttagctgggc atggtggtac      4500
     acacctgtac tttcaacatt taggacactg atgtgcaaga atcaagaagt tcagaccaga      4560
     tccagtttca cagctaaaga cacaactatc catcctacta aagaatattt attaagtgtg      4620
     cagactgcta attttttttc agaagtctgc atgcccacta ttgaattcag tagctatatt      4680
     gctcaatgcc ttggcagtcc ttatttggtc ttcctgtctg aagactagag cctcagtcac      4740
     gttcatatag agaactgtca atgccaaggt caacaggaag gcgctgggaa aggaacatcg      4800
     aactatgtag aagccacatc cggaagtagt atttgatagg tgctggggta gtgcaagagg      4860
     aacagcaaaa cagctttaga actcacggaa cgcagtctcc tggttagcac aaactcatgg      4920
     gtgggtctcc gagagaacta tgggtcctga gagcttcatg gtgtcataga gatttgctct      4980
     gcttgctgcc ttctcactgt gttactcata atctatgagt tttatgaact ctctaggggg      5040
     cttaacaacc cctcactggg cagtgtcatt gtcactcaca gcagcagtgc ttgatcttca      5100
     agatcaatga ttcaatcacc acccttggaa agaacttaga aatgtacatt gttagaaatg      5160
     accaccagtc ttaagaattt ggagaagtag attgtcagta aagttaggtt aagatgtttt      5220
     tgttaatggc tctgatgttg aaaaatctta gaaatcaaat agaaattcag aaaagcccac      5280
     ttttgattat tgatcaaggg atgttttcaa gatcaggaac aagaacaatg gcagctcagc      5340
     tagcactggc tgatgtgact cttgctgaag ctgggctgat gatcgaggtg ataattaatg      5400
     tcttgtaccc aatgtttccc cctcaccttt ctgataagat ttaataaaaa gttgtccccg      5460
     agtgaaaaaa aaaaaaaaaa aaaaaaaaaa aaaaaaa                               5497
//


spacer
spacer