spacer

EBI Dbfetch

ID   AF005202; SV 2; linear; mRNA; STD; MUS; 226 BP.
XX
AC   AF005202;
XX
DT   18-JUN-1997 (Rel. 52, Created)
DT   15-APR-2005 (Rel. 83, Last updated, Version 10)
XX
DE   Mus musculus Frizzled 1 mRNA, partial cds.
XX
KW   .
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi; Muroidea;
OC   Muridae; Murinae; Mus; Mus.
XX
RN   [1]
RP   1-226
RA   Johnson M.A., Greenberg N.M.;
RT   ;
RL   Submitted (23-MAY-1997) to the INSDC.
RL   Cell Biology, Baylor College of Medicine, One Baylor Plaza, Houston, TX
RL   77030, USA
XX
DR   MD5; 3379f473c69d3be0d3b1a858781328ca.
DR   Ensembl-Gn; ENSMUSG00000044674; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000054294; mus_musculus.
XX
CC   On Mar 29, 1999 this sequence version replaced gi:2222884.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..226
FT                   /organism="Mus musculus"
FT                   /mol_type="mRNA"
FT                   /tissue_type="dorso-lateral prostate"
FT                   /db_xref="taxon:10090"
FT   CDS             <1..>226
FT                   /codon_start=2
FT                   /product="Frizzled 1"
FT                   /note="putative transmembrane receptor; similar to Rattus
FT                   norvegicus frizzled protein encoded by GenBank Accession
FT                   Number L02529"
FT                   /db_xref="GOA:O70421"
FT                   /db_xref="InterPro:IPR000539"
FT                   /db_xref="InterPro:IPR015526"
FT                   /db_xref="InterPro:IPR017981"
FT                   /db_xref="InterPro:IPR020067"
FT                   /db_xref="InterPro:IPR026548"
FT                   /db_xref="MGI:MGI:1196625"
FT                   /db_xref="UniProtKB/Swiss-Prot:O70421"
FT                   /protein_id="AAC01952.1"
FT                   /translation="GLMYFGPEELRFSRTWIGIWSVLCCASTLFTVLTYLVDMRRFSYP
FT                   ERPIIFLSGCYTAVAVAYIAGFLLEDRVVC"
XX
SQ   Sequence 226 BP; 29 A; 70 C; 72 G; 55 T; 0 other;
     cgggctcatg tacttcgggc cagaggagct gcgcttctcg cgcacctgga taggcatctg        60
     gtccgtgctg tgctgcgcct ccacgctctt cacggtgctc acgtacctag tggacatgcg       120
     gcgcttcagc tacccggaac ggcccatcat tttcctgtcc ggctgttaca cagcggtggc       180
     ggtggcctac atcgctggct ttctgttgga ggaccgggtg gtgtgc                      226
//


spacer
spacer