Dbfetch

ID   AF004927; SV 1; linear; mRNA; STD; MUS; 1618 BP.
XX
AC   AF004927;
XX
DT   03-SEP-1998 (Rel. 56, Created)
DT   23-SEP-2008 (Rel. 97, Last updated, Version 3)
XX
DE   Mus musculus sigma 1 receptor mRNA, complete cds.
XX
KW   .
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha; Muroidea; Muridae;
OC   Murinae; Mus; Mus.
XX
RN   [1]
RP   1-1618
RX   DOI; 10.1016/S0014-2999(97)01064-9.
RX   PUBMED; 9274937.
RA   King M., Pan Y.X., Mei J., Chang A., Xu J., Pasternak G.W.;
RT   "Enhanced kappa-opioid receptor-mediated analgesia by antisense targeting
RT   the sigma1 receptor";
RL   Eur. J. Pharmacol. 331(1):R5-R6(1997).
XX
RN   [2]
RP   1-1618
RA   Pan Y.-X., Xu J., Mei J.F., King M., Cang A., Wan B.-L., Pasternak G.W.;
RT   ;
RL   Submitted (20-MAY-1997) to the INSDC.
RL   Neurology, Memorial Sloan-Kettering Cancer Center, 1275 York Ave., New
RL   York, NY 10021, USA
XX
DR   MD5; f2f7ceabfca0c613460c6c09eb8b7a57.
DR   Ensembl-Gn; ENSMUSG00000036078; mus_musculus.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0028171; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_AJ_G0028129; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AKRJ_G0028092; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_BALBcJ_G0028142; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_C3HHeJ_G0027880; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0028583; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_CASTEiJ_G0027325; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CBAJ_G0027842; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_DBA2J_G0027986; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_FVBNJ_G0027953; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_LPJ_G0028094; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0027985; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0028641; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0027044; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_WSBEiJ_G0027401; mus_musculus_wsbeij.
DR   Ensembl-Tr; ENSMUST00000059354; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000071561; mus_musculus.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0065163; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_AJ_T0065196; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AKRJ_T0065132; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_BALBcJ_T0065117; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_C3HHeJ_T0064844; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0065603; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_CASTEiJ_T0065156; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CBAJ_T0064755; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_DBA2J_T0064878; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_FVBNJ_T0064826; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_LPJ_T0065010; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0064826; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0065820; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0064675; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_WSBEiJ_T0064054; mus_musculus_wsbeij.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1618
FT                   /organism="Mus musculus"
FT                   /chromosome="4"
FT                   /map="A5-B2"
FT                   /strain="C57BL/6"
FT                   /mol_type="mRNA"
FT                   /db_xref="taxon:10090"
FT   CDS             62..733
FT                   /codon_start=1
FT                   /product="sigma 1 receptor"
FT                   /db_xref="GOA:O55242"
FT                   /db_xref="InterPro:IPR006716"
FT                   /db_xref="MGI:MGI:1195268"
FT                   /db_xref="UniProtKB/Swiss-Prot:O55242"
FT                   /protein_id="AAC33306.1"
FT                   /translation="MPWAAGRRWAWITLILTIIAVLIQAAWLWLGTQNFVFSREEIAQL
FT                   ARQYAGLDHELAFSRLIVELRRLHPGHVLPDEELQWVFVNAGGWMGAMCILHASLSEYV
FT                   LLFGTALGSHGHSGRYWAEISDTIISGTFHQWKEGTTKSEVFYPGETVVHGPGEATALE
FT                   WGPNTWMVEYGRGVIPSTLFFALADTFFSTQDYLTLFYTLRAYARGLRLELTTYLFGQD
FT                   S"
XX
SQ   Sequence 1618 BP; 374 A; 455 C; 415 G; 374 T; 0 other;
     gaacccacag cctgtggccc tagttcggtc ttacgttggt ggtgccaggc tgcccgctag        60
     aatgccgtgg gccgcgggac ggcggtgggc atggatcacc ctgattctga ctattatcgc       120
     agtgctgatc caggccgcct ggttgtggct gggcactcaa aacttcgtct tctctagaga       180
     agaaatagcg cagcttgctc gacagtatgc ggggctggac catgagcttg ccttctctcg       240
     gctgatcgtg gagctgcgga ggctgcaccc aggccacgtg ctgccggatg aggagctgca       300
     gtgggtattt gtgaacgcgg gcggctggat gggcgccatg tgtattctgc acgcctcgct       360
     gtctgagtac gtgctgctct tcggcaccgc cctgggctcc catggccatt cgggacgata       420
     ctgggctgag atttctgaca ccatcatctc tggcaccttc caccaatgga aagagggcac       480
     cacgaaaagt gaggtcttct acccaggaga gacagttgta cacgggcctg gagaagcaac       540
     ggctctggag tggggaccaa acacgtggat ggtggagtac ggccggggtg ttattccgtc       600
     taccctgttc tttgcactag ccgacacttt cttcagcacc caggactacc tcacactctt       660
     ctataccctt cgggcctatg cccggggcct ccggcttgag cttaccacct acctctttgg       720
     ccaagactcc tgaccagcca ggcctgaagg aagatctgtg gatggacagg agcgcggcag       780
     gaccacatcc atctctctac tcgctggaac tcatattcag acagcagcgt ataccatgca       840
     gatattaagt acctgctgta tgaggaagga catacatact tgtacatcca gacacagctc       900
     ttgggaagca aatgagacac agagatgcta agacttgtat gtactgtaag agtcatgcac       960
     tcacatccac ccagaaaggg tcctctacat atactccagg gggccagtca tgtttgaaca      1020
     cacatcacaa gcttgactca ctgactcagg ctttcctaga gcctcctgct ggcattcagg      1080
     gctctgggat caagggttga ggtagatgtt acacactacc tcactctgat gcctcattcc      1140
     tgtagtaatc tctggtgaag ggaaagagga gctgcccttc ggaggtcccc ttcacctgca      1200
     gctatgatgc ccttcccttc atccctttcc tcaccatatg ccttatctcc attccaatcc      1260
     tttcctatcc atatgccctt atctccattc cactcccctg cccccccccc cccggcaacc      1320
     agttcagctg ggaaagcaga ggcatgtaga ggatgctaaa gggaagggag gtcctccact      1380
     acggagaccc ttgttggggt tagaatggga aagctggcta gtgccccagg gccagttccc      1440
     aaggagagga cctggagaag taagccgggg tccaaggagc caccccattc caaaagaagc      1500
     ctttagtgtg tgtgtgcaca ccctatcagt ttccagacat atctgttgca atctctgtct      1560
     tcttgtctct ctctgttaat aaaaacatat taaacaaaaa aaaaaaaaaa aaaaaaaa        1618
//