spacer

EBI Dbfetch

ID   AF001287; SV 1; linear; mRNA; STD; MUS; 3488 BP.
XX
AC   AF001287;
XX
DT   09-SEP-1997 (Rel. 52, Created)
DT   23-SEP-2008 (Rel. 97, Last updated, Version 4)
XX
DE   Mus musculus OCAM-TM protein precursor mRNA, complete cds.
XX
KW   .
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi; Muroidea;
OC   Muridae; Murinae; Mus; Mus.
XX
RN   [1]
RP   1-837
RX   PUBMED; 9221781.
RA   Yoshihara Y., Kawasaki M., Tamada A., Fujita H., Hayashi H., Kagamiyama H.,
RA   Mori K.;
RT   "OCAM: A new member of the neural cell adhesion molecule family related to
RT   zone-to-zone projection of olfactory and vomeronasal axons";
RL   J. Neurosci. 17(15):5830-5842(1997).
XX
RN   [2]
RP   1-3488
RA   Yoshihara Y.;
RT   ;
RL   Submitted (25-APR-1997) to the INSDC.
RL   Department of Neuroscience, Osaka Bioscience Institute, 6-2-4 Furuedai,
RL   Suita, Osaka, 565, Japan
XX
DR   MD5; 1457b50354eeb79414bdddc48e1f9dd2.
DR   Ensembl-Gn; ENSMUSG00000022762; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000037785; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000067602; mus_musculus.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..3488
FT                   /organism="Mus musculus"
FT                   /strain="BALB/c"
FT                   /mol_type="mRNA"
FT                   /dev_stage="adult"
FT                   /clone="104"
FT                   /tissue_type="olfactory neuroepithelium"
FT                   /db_xref="taxon:10090"
FT   5'UTR           1..143
FT   sig_peptide     144..200
FT   CDS             144..2657
FT                   /codon_start=1
FT                   /product="OCAM-TM protein precursor"
FT                   /db_xref="GOA:O35136"
FT                   /db_xref="InterPro:IPR003598"
FT                   /db_xref="InterPro:IPR003961"
FT                   /db_xref="InterPro:IPR007110"
FT                   /db_xref="InterPro:IPR009138"
FT                   /db_xref="InterPro:IPR013098"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="MGI:MGI:97282"
FT                   /db_xref="UniProtKB/Swiss-Prot:O35136"
FT                   /protein_id="AAB69125.1"
FT                   /translation="MSLLLSFYLLGLLVRSGQALLQVTISLSKVELSVGESKFFTCTAI
FT                   GEPESIDWYNPQGEKIISTQRVMLQKEGVRSRLTIYNANIEDAGIYRCQATDAKGQTQE
FT                   ATVVLEIYQKLTFREVVSPQEFKQGEDAEVVCRVSSSPAPAVSWLYHNEEVTTIPDNRF
FT                   AVLANNNLQILNINKSDEGIYRCEGRVEARGEIDFRDIIVIVNVPPAIMMPQKSFNATA
FT                   ERGEEMTLTCKASGSPDPTISWFRNGKLIEENEKYILKGSNTELTVRNIINKDGGSYVC
FT                   KATNKAGEDQKQAFLQVFVQPHILQLKNETTSENGHVTLVCEAEGEPVPEITWKRAIDG
FT                   VMFSEGDKSPDGRIEVKGQHGRSSLHIRDVKLSDSGRYDCEAASRIGGHQRSMHLDIEY
FT                   APKFVSNQTMYYSWEGNPINISCDVTANPPASIHWRREKLLLPAKNTTHLKTHSVGRKM
FT                   ILEIAPTSDNDFGRYNCTATNRIGTRFQEYILELADVPSSPHGVKIIELSQTTAKISFN
FT                   KPESHGGVPIHHYQVDVKEVASETWKIVRSHGVQTMVVLSSLEPNTTYEIRVAAVNGKG
FT                   QGDYSKIEIFQTLPVREPSPPSIHGQPSSGKSFKISITKQDDGGAPILEYIVKYRSKDK
FT                   EDQWLEKKVQGNKDHIILEHLQWTMGYEVQITAANRLGYSEPTVYEFSMPPKPNIIKDT
FT                   LFNGLGLGAIIGLGVAALLLILVVTDVSCFFIRQCGLLMCITRRMCGKKSGSSGKSKEL
FT                   EEGKAAYLKDGSKEPIVEMRTEDERITNHEDGSPVNEPNETTPLTEPEKLPLKEENGKE
FT                   VLNAETIEIKVSNDIIQSKEDDIKA"
FT   mat_peptide     201..2654
FT                   /product="OCAM-TM protein"
FT   3'UTR           2658..3488
XX
SQ   Sequence 3488 BP; 1121 A; 693 C; 818 G; 856 T; 0 other;
     gacgagcgcg cggcgggctg cgggcggctg gggcacccgg gagcggcggc gggctagcag        60
     aggcggccgt ggcagcggaa ggttctctct ccggggctgg acttaataac tttggaactg       120
     tccgccggtg tcacgtcctg aacatgagcc tcctcctctc cttctacctg ctcgggttgc       180
     ttgtcaggag cgggcaagct cttcttcaag tgacaatttc acttagcaaa gtagagctta       240
     gtgtgggtga gtctaaattc ttcacatgta cagccattgg tgagcctgag agtatcgact       300
     ggtataaccc tcaaggagag aagatcattt caacgcagag ggttatgcta cagaaggagg       360
     gtgtcaggtc acgactcacc atctacaatg caaacataga agatgcaggg atatatcgct       420
     gtcaagcgac agatgccaaa ggacagacac aagaagctac agtagttttg gaaatttacc       480
     aaaaactcac cttcagagaa gtggtgtccc ctcaagagtt caagcaaggg gaggatgcag       540
     aagtggtttg cagagtgagc agttccccag cccctgcggt cagctggttg taccacaatg       600
     aggaagtcac caccatcccc gacaatcggt ttgcagtgct tgcaaacaat aatttgcaga       660
     tcctcaatat caataaaagt gatgaaggta tatacagatg tgaaggaaga gtggaggcga       720
     ggggagagat tgacttccgg gatatcattg ttattgttaa cgttccacca gcaatcatga       780
     tgccccagaa gtccttcaat gctacagcag agagaggaga agagatgacc ttaacatgca       840
     aggcctcggg ctccccagat ccaaccatct cttggttcag gaacggcaaa ctcattgaag       900
     aaaatgaaaa gtatatttta aagggcagta atacagagct cactgtcagg aacataatca       960
     ataaagacgg gggctcttat gtctgcaaag caacaaacaa ggcaggagaa gatcaaaagc      1020
     aggccttcct tcaagtcttt gtacagcctc atatattaca acttaaaaat gagacaacat      1080
     ctgagaatgg tcatgtcaca ctcgtatgtg aagcagaagg ggagcctgtt ccagaaatca      1140
     catggaaaag agccatagat ggagtcatgt tttctgaagg tgataagagt ccggatggcc      1200
     gcatcgaagt taaagggcag catggacgct cttcactgca cattagagat gtgaagttgt      1260
     cagattcggg gagatatgac tgtgaggccg ctagtcggat tggtgggcac cagaggagca      1320
     tgcacctgga catcgaatat gctcctaagt ttgtttcaaa tcagacaatg tattactctt      1380
     gggaaggaaa tccaatcaac ataagttgtg atgtgacagc aaacccacct gcgtcaatcc      1440
     actggagaag agagaaactg ctcttaccag ctaagaatac gactcattta aaaactcaca      1500
     gtgtaggaag aaagatgata ctcgagattg cccccacatc agacaatgac tttggacgat      1560
     ataactgcac agctactaac cgtataggca caagatttca ggaatatatt cttgaattag      1620
     cagatgtccc ctctagtccc catggagtga agattataga gctgtcacag accacagcca      1680
     agatctcttt caataaaccc gaatcccatg gaggtgtgcc tattcatcac tatcaagtgg      1740
     atgtcaaaga agtggcatca gaaacctgga aaatagtacg ctcccatgga gttcaaacga      1800
     tggttgtttt gagcagtctg gaaccaaata cgacttacga aattagggtt gcagcagtga      1860
     atggcaaagg tcaaggagac tacagtaaaa tagaaatatt ccagacactg ccagtccgtg      1920
     agccaagtcc cccttccata catggacagc caagcagtgg caagagtttt aaaatcagca      1980
     tcaccaagca agatgatgga ggggctccta ttttagaata cattgtaaaa tacagaagta      2040
     aagacaagga agatcagtgg ctagagaaga aggtacaggg aaataaagac cacattatct      2100
     tggagcatct gcagtggaca atgggctacg aagtgcaaat cacagctgcc aacagactgg      2160
     gatattctga gcctactgta tatgagttca gcatgccccc aaaacccaac attattaaag      2220
     acacactttt taatggcctt ggcctaggag ccatcattgg ccttggagtt gctgcccttt      2280
     tgctaatcct tgtggtaaca gacgtcagct gcttcttcat tcgacaatgt gggttactaa      2340
     tgtgcatcac caggagaatg tgcgggaaaa agagtggctc cagtgggaaa agtaaagaac      2400
     ttgaagaagg aaaagcagct tacctgaaag atggatcaaa agaaccgata gtggaaatga      2460
     gaacagaaga tgaaagaatc actaaccatg aagatgggag tccagtaaat gagccaaatg      2520
     aaaccacacc gctaacagaa cctgaaaaat tgcctttaaa agaagaaaac ggaaaggaag      2580
     ttttaaacgc agaaactata gaaattaaag tgtccaatga catcatccag tctaaagaag      2640
     atgacataaa ggcatgacaa caagtttcag caccttggtc agcacctcaa ggagcatttg      2700
     gtttggagtg acactatgac caaaactatt ccattgacct taatttctcg ggaaaagtct      2760
     agctggaata gcttgtacac atatacatac gacaaaactc ctctggccac aacccatttc      2820
     tttctgttat tgtggtggtt gtttattttg ttaagaattc ggtataaaga cttgattggc      2880
     accaattttg gggtttcagt tcgattctat aattgaagta ctgcaattta ttagatggct      2940
     aaagtgggtt tttttttttt gtcttatata acacaaacaa atatgtttct ctctaaaata      3000
     ttaggttgta atggaaggca gagaaaaacg tttgtgagct aaatgtggga agtgtatgaa      3060
     agccctgcat gtttataaat cttatcttgg gcaaacacac tattgtgagg gtctttcaga      3120
     ctaagacgaa ggcacataat aaagggtatg ctttttatca ggggaatttc agggaaccca      3180
     ggcttgaaag ggccagtcag ttatcttttg cagatattag aaattgaaac attgttggag      3240
     aactcttttc accttatgac cacactgcat ttttcgacat tgatcttacg tacactgata      3300
     ccaggacaaa attgttacac atttgaaaga agattagttg tgtgtaaaat tagattagaa      3360
     agatccctaa atctcttttt atgtatacca tattcaccca cagtggatta cacaaaaagt      3420
     aaatgtatta caagtaaaaa tggtattgat ttctgccctc agcttcaaat aaagtgaatt      3480
     taaatggg                                                               3488
//


spacer
spacer