Dbfetch

ID   AF001286; SV 1; linear; mRNA; STD; MUS; 4821 BP.
XX
AC   AF001286;
XX
DT   09-SEP-1997 (Rel. 52, Created)
DT   23-SEP-2008 (Rel. 97, Last updated, Version 4)
XX
DE   Mus musculus OCAM-GPI protein precursor mRNA, complete cds.
XX
KW   .
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi; Muroidea;
OC   Muridae; Murinae; Mus; Mus.
XX
RN   [1]
RP   1-727
RX   PUBMED; 9221781.
RA   Yoshihara Y., Kawasaki M., Tamada A., Fujita H., Hayashi H., Kagamiyama H.,
RA   Mori K.;
RT   "OCAM: A new member of the neural cell adhesion molecule family related to
RT   zone-to-zone projection of olfactory and vomeronasal axons";
RL   J. Neurosci. 17(15):5830-5842(1997).
XX
RN   [2]
RP   1-4821
RA   Yoshihara Y.;
RT   ;
RL   Submitted (25-APR-1997) to the INSDC.
RL   Department of Neuroscience, Osaka Bioscience Institute, 6-2-4 Furuedai,
RL   Suita, Osaka, 565, Japan
XX
DR   MD5; 0e831364b88a6278a0afccf35fb0d578.
DR   Ensembl-Gn; ENSMUSG00000022762; mus_musculus.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0022966; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_AJ_G0022934; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AKRJ_G0022904; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_BALBcJ_G0022936; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_C3HHeJ_G0022698; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0023383; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_CASTEiJ_G0022220; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CBAJ_G0022667; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_DBA2J_G0022801; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_FVBNJ_G0022776; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_LPJ_G0022870; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0022795; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0023401; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0021962; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_WSBEiJ_G0022268; mus_musculus_wsbeij.
DR   Ensembl-Tr; ENSMUST00000037785; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000067602; mus_musculus.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0044910; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_AJ_T0044892; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AKRJ_T0044862; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_BALBcJ_T0044868; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_C3HHeJ_T0044607; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0045348; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_CASTEiJ_T0044729; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CBAJ_T0044519; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_DBA2J_T0044672; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_FVBNJ_T0044622; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_LPJ_T0044746; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0044601; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0045405; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0044306; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_WSBEiJ_T0043976; mus_musculus_wsbeij.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..4821
FT                   /organism="Mus musculus"
FT                   /strain="BALB/c"
FT                   /mol_type="mRNA"
FT                   /dev_stage="adult"
FT                   /clone="102"
FT                   /tissue_type="olfactory neuroepithelium"
FT                   /db_xref="taxon:10090"
FT   5'UTR           1..143
FT   sig_peptide     144..200
FT   CDS             144..2327
FT                   /codon_start=1
FT                   /product="OCAM-GPI protein precursor"
FT                   /db_xref="GOA:O35136"
FT                   /db_xref="InterPro:IPR003598"
FT                   /db_xref="InterPro:IPR003599"
FT                   /db_xref="InterPro:IPR003961"
FT                   /db_xref="InterPro:IPR007110"
FT                   /db_xref="InterPro:IPR009138"
FT                   /db_xref="InterPro:IPR013098"
FT                   /db_xref="InterPro:IPR013106"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="MGI:MGI:97282"
FT                   /db_xref="UniProtKB/Swiss-Prot:O35136"
FT                   /protein_id="AAB69124.1"
FT                   /translation="MSLLLSFYLLGLLVRSGQALLQVTISLSKVELSVGESKFFTCTAI
FT                   GEPESIDWYNPQGEKIISTQRVMLQKEGVRSRLTIYNANIEDAGIYRCQATDAKGQTQE
FT                   ATVVLEIYQKLTFREVVSPQEFKQGEDAEVVCRVSSSPAPAVSWLYHNEEVTTIPDNRF
FT                   AVLANNNLQILNINKSDEGIYRCEGRVEARGEIDFRDIIVIVNVPPAIMMPQKSFNATA
FT                   ERGEEMTLTCKASGSPDPTISWFRNGKLIEENEKYILKGSNTELTVRNIINKDGGSYVC
FT                   KATNKAGEDQKQAFLQVFVQPHILQLKNETTSENGHVTLVCEAEGEPVPEITWKRAIDG
FT                   VMFSEGDKSPDGRIEVKGQHGRSSLHIRDVKLSDSGRYDCEAASRIGGHQRSMHLDIEY
FT                   APKFVSNQTMYYSWEGNPINISCDVTANPPASIHWRREKLLLPAKNTTHLKTHSVGRKM
FT                   ILEIAPTSDNDFGRYNCTATNRIGTRFQEYILELADVPSSPHGVKIIELSQTTAKISFN
FT                   KPESHGGVPIHHYQVDVKEVASETWKIVRSHGVQTMVVLSSLEPNTTYEIRVAAVNGKG
FT                   QGDYSKIEIFQTLPVREPSPPSIHGQPSSGKSFKISITKQDDGGAPILEYIVKYRSKDK
FT                   EDQWLEKKVQGNKDHIILEHLQWTMGYEVQITAANRLGYSEPTVYEFSMPPKPNIIKDN
FT                   CCEANKGENGGQSWHLNAVGFTFVITMSLSCLF"
FT   mat_peptide     201..2324
FT                   /product="OCAM-GPI protein"
FT   3'UTR           2328..4821
XX
SQ   Sequence 4821 BP; 1584 A; 927 C; 922 G; 1388 T; 0 other;
     gacgagcgcg cggcgggctg cgggcggctg gggcacccgg gagcggcggc gggctagcag        60
     aggcggccgt ggcagcggaa ggttctctct ccggggctgg acttaataac tttggaactg       120
     tccgccggtg tcacgtcctg aacatgagcc tcctcctctc cttctacctg ctcgggttgc       180
     ttgtcaggag cgggcaagct cttcttcaag tgacaatttc acttagcaaa gtagagctta       240
     gtgtgggtga gtctaaattc ttcacatgta cagccattgg tgagcctgag agtatcgact       300
     ggtataaccc tcaaggagag aagatcattt caacgcagag ggttatgcta cagaaggagg       360
     gtgtcaggtc acgactcacc atctacaatg caaacataga agatgcaggg atatatcgct       420
     gtcaagcgac agatgccaaa ggacagacac aagaagctac agtagttttg gaaatttacc       480
     aaaaactcac cttcagagaa gtggtgtccc ctcaagagtt caagcaaggg gaggatgcag       540
     aagtggtttg cagagtgagc agttccccag cccctgcggt cagctggttg taccacaatg       600
     aggaagtcac caccatcccc gacaatcggt ttgcagtgct tgcaaacaat aatttgcaga       660
     tcctcaatat caataaaagt gatgaaggta tatacagatg tgaaggaaga gtggaggcga       720
     ggggagagat tgacttccgg gatatcattg ttattgttaa cgttccacca gcaatcatga       780
     tgccccagaa gtccttcaat gctacagcag agagaggaga agagatgacc ttaacatgca       840
     aggcctcggg ctccccagat ccaaccatct cttggttcag gaacggcaaa ctcattgaag       900
     aaaatgaaaa gtatatttta aagggcagta atacagagct cactgtcagg aacataatca       960
     ataaagacgg gggctcttat gtctgcaaag caacaaacaa ggcaggagaa gatcaaaagc      1020
     aggccttcct tcaagtcttt gtacagcctc atatattaca acttaaaaat gagacaacat      1080
     ctgagaatgg tcatgtcaca ctcgtatgtg aagcagaagg ggagcctgtt ccagaaatca      1140
     catggaaaag agccatagat ggagtcatgt tttctgaagg tgataagagt ccggatggcc      1200
     gcatcgaagt taaagggcag catggacgct cttcactgca cattagagat gtgaagttgt      1260
     cagattcggg gagatatgac tgtgaggccg ctagtcggat tggtgggcac cagaggagca      1320
     tgcacctgga catcgaatat gctcctaagt ttgtttcaaa tcagacaatg tattactctt      1380
     gggaaggaaa tccaatcaac ataagttgtg atgtgacagc aaacccacct gcgtcaatcc      1440
     actggagaag agagaaactg ctcttaccag ctaagaatac gactcattta aaaactcaca      1500
     gtgtaggaag aaagatgata ctcgagattg cccccacatc agacaatgac tttggacgat      1560
     ataactgcac agctactaac cgtataggca caagatttca ggaatatatt cttgaattag      1620
     cagatgtccc ctctagtccc catggagtga agattataga gctgtcacag accacagcca      1680
     agatctcttt caataaaccc gaatcccatg gaggtgtgcc tattcatcac tatcaagtgg      1740
     atgtcaaaga agtggcatca gaaacctgga aaatagtacg ctcccatgga gttcaaacga      1800
     tggttgtttt gagcagtctg gaaccaaata cgacttacga aattagggtt gcagcagtga      1860
     atggcaaagg tcaaggagac tacagtaaaa tagaaatatt ccagacactg ccagtccgtg      1920
     agccaagtcc cccttccata catggacagc caagcagtgg caagagtttt aaaatcagca      1980
     tcaccaagca agatgatgga ggggctccta ttttagaata cattgtaaaa tacagaagta      2040
     aagacaagga agatcagtgg ctagagaaga aggtacaggg aaataaagac cacattatct      2100
     tggagcatct gcagtggaca atgggctacg aagtgcaaat cacagctgcc aacagactgg      2160
     gatattctga gcctactgta tatgagttca gcatgccccc aaaacccaac attattaaag      2220
     ataattgctg tgaagcgaat aaaggtgaaa atggaggcca gtcatggcat ctgaatgctg      2280
     ttgggtttac ttttgtaata accatgagtt tgtcttgttt gttttagtgt tctatgttct      2340
     atggtactcc ctgatcagag ataaaagagt ccaggtacag gctaatcaaa aattttaatc      2400
     aacattttca gtccagttca atttatgttt acacaattcg ccttccccct gaattcagta      2460
     ctttctctaa ttttatctgt gtaatttgga agaaagcaat gcagaaagaa attacagaag      2520
     aagttttttc ttgcaaatac tttttcagta acaatatgtt tgactccaaa tccattactt      2580
     tgcaaagtag actttgttac attgaattta atttctatag tgggtcttgc tttcatttca      2640
     gtatgcaaat atcattcaac atccatccat aagtataaaa caagtaaatt tttgttttac      2700
     aaaattgtga atcacttcta acaagtcttt aatactgtta aaagaaaatt tctggttttg      2760
     tgaacatttt ctcgatttta tagtgcctac catttatata aatcataagc ttgataccct      2820
     attatatcag gtacatctat ttcttgttct gctttctgta gtttgagata aacactctct      2880
     gaagaaacaa aatataatca aatttccttt catttttgaa catccaatta acattttctt      2940
     aagtgaatat gcgtctctcc cattatcgat aataagtaaa cttaatctca gtacatttaa      3000
     atgctactaa gttcagtatg ttcacaggaa cctttggcca gtggtgcaga tctaaatctg      3060
     ttccaggtat ctatttcatt ttcactactg ctgacattcc ctctcttttg caagcatcag      3120
     aatacaaagt ggccatttta ggcattactt taaaggaggt ggaaatgaga gggaaacaag      3180
     aggctgctgt attcagataa aaacaaaaca aaacaaaaca aagcaaagca aaacaaaacc      3240
     aaagtaaaac acacaaaccc aaactgaaac caaccaacca aacaaacaaa caaaaaactc      3300
     aattggaaaa aatacaggaa aaattgtatg tctttctcaa gtttcggtta ttcgttaatg      3360
     agaggaatgt gctgttagct ttgaatcaca tcctatgaaa taatgattag tatttaaggc      3420
     agttaagaaa ccacacatgc accaacagac acacacacac acacaccaac actcacacac      3480
     atgcacatac aaccacacca tatagacaaa tataaccatc tttacttgct caatcaaaaa      3540
     ataaaaaaca aaaattacag cttttgagat tcaaccccta aaataaagta ttcagttctc      3600
     tgaaaaaact gttcctaatt ttgggatacc caaacatatt actgcttatg tgaggtccaa      3660
     agagattata tgtgcattag tttccagctt tattttaatt tataatttaa aacatctagc      3720
     tttcaattat ttttttatct tataatttgc aaagtaacct gcaaaatgat ttgtttaaag      3780
     acaatttttt tcctccttgc tccaacaaca aaaattggta attattatag tatggaaaca      3840
     taattgacat ctcgggatat ttttttttgc aatataacat gacccatgct ttatatatac      3900
     atatatatga attagatttg aattagattt cttgatattt gcctgaataa atgatatgat      3960
     cattactgat gagtagaaaa tattgagaat gatcatattc aagaaaaaca cttctaaacg      4020
     tctttcatcc catccataat cctagatgct aaatatttcc atgaaaatgt catccgttat      4080
     ttaacttgac ttgaaatcac aaatcatttg gaacacagga aatgtttgct tagtcagtta      4140
     cattgattga tttttttaag tttatatccc agaactacac attaccaaga gtgataccaa      4200
     aaatagtcgg tgtcacggtt acacagaaat gtatcatttt ggaaaacaca aaataactgt      4260
     attttactaa aggatcatag aaattacact tacttaagga aatggcaagg ctcttgttcg      4320
     ttttattgtc caagttacat tattgtgtaa agtcataagc cacttctctt tacccatttg      4380
     tgcccttagg aacagtcatt gataatgtgc cctgtgataa ggaaatcata aaaaaaaaat      4440
     ccatatactt cttaatttct tctctatatt tttcctgttt gctttttaaa taaattccaa      4500
     ttgttgaaag tataggcata tgtgtaataa ggtgagttac tattaaccat tatatgtagg      4560
     tagttagaaa acttttgatc taacagtctg tgtatcacaa tttatagtgt tgaaatattt      4620
     cagtagattt tgaacagtgt aacagtgatg gagcttagcg gatttgcatg ctttcccagt      4680
     ttatctgtat ggatatgtgt caagtcaggc tatcctttta gtcatttcag agtgtctcca      4740
     ctttcccttc tttttttttt ttttcccatt ttttattagg tatttaactc atttacattt      4800
     ccaatgctat accaaaagtc c                                                4821
//