spacer

EBI Dbfetch

ID   AB485773; SV 1; linear; genomic DNA; STD; HUM; 492 BP.
XX
AC   AB485773;
XX
DT   27-FEB-2009 (Rel. 100, Created)
DT   27-FEB-2009 (Rel. 100, Last updated, Version 1)
XX
DE   Homo sapiens HLA-DRB1 gene for MHC class II antigen, partial cds, allele:
DE   DRB1*1403.
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-492
RA   Maruya E., Matushita M., Saji H.;
RT   ;
RL   Submitted (23-FEB-2009) to the INSDC.
RL   Contact:Etsuko Maruya HLA Laboratory, NPO, Research; Kawabata-Marutamachi,
RL   Sakyoku, Kyoto, Kyoto 606-8396, Japan URL    :http://hla.or.jp/
XX
RN   [2]
RA   Maruya E., Matsushita M., Saji H., Ounuma T., Futagami T., Kojima H.,
RA   Tujino T., Hayashi K., Kusunoki Y., Yoshida T., Maekawajiri S.;
RT   "HLA-DR new allele related with DRB1*1403";
RL   Unpublished.
XX
DR   MD5; 4bb4f1eda9359ab2410bcbc51fadbda2.
DR   Ensembl-Gn; ENSG00000196126; homo_sapiens.
DR   Ensembl-Gn; ENSG00000206240; homo_sapiens.
DR   Ensembl-Gn; ENSG00000206306; homo_sapiens.
DR   Ensembl-Gn; ENSG00000228080; homo_sapiens.
DR   Ensembl-Tr; ENST00000328980; homo_sapiens.
DR   Ensembl-Tr; ENST00000360004; homo_sapiens.
DR   Ensembl-Tr; ENST00000399450; homo_sapiens.
DR   Ensembl-Tr; ENST00000412634; homo_sapiens.
DR   Ensembl-Tr; ENST00000415796; homo_sapiens.
DR   Ensembl-Tr; ENST00000419393; homo_sapiens.
DR   Ensembl-Tr; ENST00000428566; homo_sapiens.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..492
FT                   /organism="Homo sapiens"
FT                   /chromosome="6"
FT                   /mol_type="genomic DNA"
FT                   /country="Japan"
FT                   /db_xref="taxon:9606"
FT   CDS             <178..>448
FT                   /codon_start=3
FT                   /transl_table=1
FT                   /gene="HLA-DRB1"
FT                   /allele="DRB1*1403"
FT                   /product="MHC class II antigen"
FT                   /db_xref="GOA:Q9GIY3"
FT                   /db_xref="HGNC:HGNC:4948"
FT                   /db_xref="IMGT/HLA:DRB1*14:85"
FT                   /db_xref="InterPro:IPR000353"
FT                   /db_xref="InterPro:IPR003006"
FT                   /db_xref="InterPro:IPR003597"
FT                   /db_xref="InterPro:IPR007110"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR014745"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9GIY3"
FT                   /protein_id="BAH23562.1"
FT                   /translation="RFLEYSTSECHFFNGTERVRFLERYFHNQEENVRFDSDVGEYRAV
FT                   TELGRPSAEYWNSQKDLLEDRRALVDTYCRHNYGVGESFTVQRRG"
XX
SQ   Sequence 492 BP; 87 A; 131 C; 185 G; 89 T; 0 other;
     tttcgcctca ggaagacaga ggaggagccc ctgggctgct ggtggtgggc gttgcggcgg        60
     gggccggtta aggttcccag tgcccgcacc ccacccaggg agccccggat ggcggcgtca       120
     ctgtcagtgt cttctcagga ggccgcctgt gtgactggat cgttcgtgtc cccacagcac       180
     gtttcttgga gtactctacg tctgagtgtc atttcttcaa tgggacggag cgggtgcggt       240
     tcctggagag atacttccat aaccaggagg agaacgtgcg cttcgacagc gacgtggggg       300
     agtaccgggc ggtgacggag ctggggcggc ctagcgccga gtactggaac agccagaagg       360
     acctcctgga agacaggcgg gccctggtgg acacctactg cagacacaac tacggggttg       420
     gtgagagctt cacagtgcag cggcgaggtg agcgcggcgc ggggcggggc ctgagtccct       480
     gtgagctggg aa                                                           492
//


spacer
spacer