Dbfetch

ID   AB265788; SV 1; linear; mRNA; STD; MUS; 1678 BP.
XX
AC   AB265788;
XX
DT   24-JUN-2007 (Rel. 92, Created)
DT   01-AUG-2007 (Rel. 92, Last updated, Version 2)
XX
DE   Mus musculus slc16a2 mRNA for solute carrier family 16 member 2, complete
DE   cds.
XX
KW   .
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi; Muroidea;
OC   Muridae; Murinae; Mus; Mus.
XX
RN   [1]
RP   1-1678
RA   Sugiura M., Nagaoka M., Yabuuchi H., Akaike T.;
RT   ;
RL   Submitted (11-JUL-2006) to the INSDC.
RL   Masato Nagaoka, Tokyo Institute of Technology, Department of Biomolecular
RL   Engineering, Graduate School of Bioscience and Biotechnology; 4259-B-57
RL   Nagatsuta-cho, Midori-ku, Yokohama 226-8501, Japan
RL   (E-mail:mnagaoka@bio.titech.ac.jp, Tel:81-45-924-5809, Fax:81-45-924-5815)
XX
RN   [2]
RX   DOI; 10.1016/j.bbrc.2007.06.109.
RX   PUBMED; 17624308.
RA   Sugiura M., Nagaoka M., Yabuuchi H., Akaike T.;
RT   "Overexpression of MCT8 enhances the differentiation of ES cells into
RT   neural progenitors";
RL   Biochem. Biophys. Res. Commun. 360(4):741-745(2007).
XX
DR   MD5; 38b6077da68e35daa56b804d300ea11f.
DR   Ensembl-Gn; ENSMUSG00000033965; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000042664; mus_musculus.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1678
FT                   /organism="Mus musculus"
FT                   /mol_type="mRNA"
FT                   /sex="male"
FT                   /tissue_type="liver"
FT                   /db_xref="taxon:10090"
FT   CDS             13..1650
FT                   /codon_start=1
FT                   /transl_table=1
FT                   /gene="slc16a2"
FT                   /product="solute carrier family 16 member 2"
FT                   /db_xref="GOA:Q05BA2"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR030761"
FT                   /db_xref="MGI:MGI:1203732"
FT                   /db_xref="UniProtKB/TrEMBL:Q05BA2"
FT                   /protein_id="BAF64537.1"
FT                   /translation="MALPSPASEEAEGPCQEANQEYQEPVCSPVPEPEPEPEPEPEPDP
FT                   EPVPVPPPEPQPEPEPQPLPDPAPLPELGFEAEPVQEPEPTPTVETRGTARGFQPPEGG
FT                   FGWIVVFAATWCNGSIFGIHNSVGILYSMLLEEEKEKNRQVEFQAAWVGALAMGMIFFC
FT                   SPIVSIFTDRLGCRITATTGAAVAFIGLHTSSFTSSLSLRYFTYGILFGCGCSFAFQPS
FT                   LVILGHYFQRRLGLANGVVSAGSSIFSMSFPFLIKMLGDKIKLAQTFQVLSTFMFVLTL
FT                   LSLTYRPLLPSSQDTPSKRGAHTLRQRFLVQFRKYFNMRVFRQRTYRIWAFGIAAAALG
FT                   YFVPYVHLMKYVEDKFKEIKETWVLLVCIGATSGLGRLVSGHISDSIPGLKKIYLQVLS
FT                   FLLLGLMSMMIPLCRDFGGLIVVCLFLGLCDGFFITIMAPIAFELVGPMQASQAIGYLL
FT                   GMMALPMIAGPPIAGLLRNCFGDYHVAFYFAGVPPIIGAVILFFVPLMHQRMFKKEQRD
FT                   SSKDKMLSHDPDPNGELLPGSPTPEEPI"
XX
SQ   Sequence 1678 BP; 322 A; 525 C; 426 G; 405 T; 0 other;
     cccctagcca cgatggcgct gccaagcccg gcgagcgagg aagctgaggg gccctgtcag        60
     gaggcaaacc aggaatatca ggagccggtg tgtagtcctg tgcccgagcc ggagccagag       120
     ccggagcccg aaccggagcc tgaccccgag ccggtgccag tgcccccgcc cgagcctcag       180
     cctgagcccg agccccagcc cctacccgat cctgcacccc tgccggagct gggctttgag       240
     gctgagccag tgcaagaacc cgagcccacg cccactgtgg aaacccgagg caccgcgcgt       300
     ggctttcagc ctcccgaagg tggcttcggc tggatagtgg tgtttgcagc cacctggtgc       360
     aacggctcca tcttcggcat ccataactct gttggtatcc tctactccat gctactagag       420
     gaggaaaaag agaaaaatcg ccaagtggag ttccaagcag catgggtcgg agccctcgct       480
     atgggcatga tcttcttctg ttctcccatt gtgagtatat tcactgaccg tttgggctgc       540
     cgaatcacag ccaccaccgg ggccgctgtt gctttcattg gcctccacac cagctccttc       600
     accagctccc taagcctgcg ctacttcacc tatgggattc tgtttggttg tggctgctca       660
     ttcgcctttc aaccatcact cgtcatcctg ggccactact ttcaacgtcg cctaggtcta       720
     gccaatggtg tggtatctgc tggaagtagc atcttctcca tgtcttttcc cttcctcatc       780
     aaaatgctgg gggataaaat caagctggcc caaaccttcc aggtgctgag taccttcatg       840
     tttgtcctta cgctgctctc actcacttac cggcccctcc tgccaagctc ccaggacacc       900
     ccaagcaaga gaggtgccca caccctgcga cagcgctttc tggttcagtt cagaaagtac       960
     ttcaacatgc gtgtattccg ccagcgcact taccgtatct gggcctttgg gatcgctgct      1020
     gctgcccttg gttacttcgt cccctacgtg cacctgatga aatatgtgga agataagttc      1080
     aaggagatca aggagacctg ggtgctcttg gtgtgcattg gggctacgtc aggcctcgga      1140
     cgtctcgtct cgggccacat cagtgactcc atccctggac ttaagaagat atacttgcag      1200
     gtcctctcat tcctgctcct gggcttgatg tccatgatga tccccctatg ccgggacttc      1260
     gggggcctta tcgttgtctg cctcttcctg ggcctatgtg atggcttctt cattaccatc      1320
     atggctccca ttgcatttga gctggtggga cccatgcagg cctcacaggc cattggctac      1380
     ctcctgggca tgatggccct gccaatgatt gctgggcccc ccattgcagg cctccttcga      1440
     aactgctttg gtgattacca tgtggccttc tactttgcgg gtgtcccccc aatcattgga      1500
     gctgtgatcc ttttcttcgt ccctctgatg catcaaagga tgtttaagaa agagcagaga      1560
     gattccagca aggataagat gctgtcccac gatccagacc ccaacggaga actgctgcca      1620
     ggctccccaa cacctgaaga gcccatttaa tgcctctgtc ttgccattgt gtgctcct        1678
//