spacer

EBI Dbfetch

ID   AB259050; SV 1; linear; mRNA; STD; MUS; 414 BP.
XX
AC   AB259050;
XX
DT   19-AUG-2006 (Rel. 88, Created)
DT   23-SEP-2008 (Rel. 97, Last updated, Version 2)
XX
DE   Mus musculus CaV1.2-b mRNA for voltage-dependent calcium channel splice
DE   variant 1.2-b, partial cds.
XX
KW   .
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi; Muroidea;
OC   Muridae; Murinae; Mus; Mus.
XX
RN   [1]
RP   1-414
RA   Murakami M.;
RT   ;
RL   Submitted (03-MAY-2006) to the INSDC.
RL   Manabu Murakami, Akita University School of Medicine, Deaprtment of
RL   Pharmacology; 1-1-1 Hondoh, Akita 010-8543, Japan
RL   (E-mail:mmura0123@hotmail.co.jp, Tel:81-18-884-6067, Fax:81-18-836-2603)
XX
RN   [2]
RX   DOI; 10.1016/j.yjmcc.2006.05.002.
RX   PUBMED; 16787652.
RA   Murakami M., Ohba T., Takahashi Y., Watanabe H., Miyoshi I., Nakayama S.,
RA   Ono K., Ito H., Iijima T.;
RT   "Identification of a cardiac isoform of the murine calcium channel alpha1C
RT   (Cav1.2-a) subunit and its preferential binding with the beta2 subunit";
RL   J. Mol. Cell. Cardiol. 41(1):115-125(2006).
XX
DR   MD5; 7b17e87cb08865325de46bf78faf142a.
DR   Ensembl-Gn; ENSMUSG00000051331; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000112793; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000112825; mus_musculus.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..414
FT                   /organism="Mus musculus"
FT                   /mol_type="mRNA"
FT                   /tissue_type="aorta"
FT                   /db_xref="taxon:10090"
FT   CDS             <1..>414
FT                   /gene="CaV1.2-b"
FT                   /product="voltage-dependent calcium channel splice variant
FT                   1.2-b"
FT                   /db_xref="GOA:Q0PCR5"
FT                   /db_xref="InterPro:IPR002077"
FT                   /db_xref="InterPro:IPR005821"
FT                   /db_xref="MGI:MGI:103013"
FT                   /db_xref="UniProtKB/TrEMBL:Q0PCR5"
FT                   /protein_id="BAF03166.1"
FT                   /translation="TMEGWTDVLYWVNDAVGRDWPWIYFVTLIIIGSFFVLNLVLGVLS
FT                   GEFSKEREKAKARGDFQKLREKQQLEEDLKGYLDWITQAEDIDPENEDEGMDEDKPRNR
FT                   GAPAGLHDQKKGKFAWFSHSTETHVSMPTSETES"
XX
SQ   Sequence 414 BP; 120 A; 86 C; 120 G; 88 T; 0 other;
     accatggagg gctggacaga cgtgctgtac tgggtcaatg atgccgtagg aagggactgg        60
     ccctggatct attttgtaac actaatcatc atagggtcat tttttgtact taacttggtt       120
     ctcggtgttc ttagcgggga gttttccaaa gagagggaga aagccaaagc ccgaggagat       180
     ttccagaagc ttcgagagaa gcagcaacta gaagaagatc tcaaaggcta cctggactgg       240
     atcacccagg cagaagacat tgaccccgag aatgaggacg agggcatgga tgaagacaag       300
     cctcgaaaca gaggcgctcc agcgggcttg catgatcaga agaaagggaa gtttgcttgg       360
     tttagtcact ctacagaaac ccatgtgagc atgcccacaa gtgagactga gtct             414
//


spacer
spacer