spacer

EBI Dbfetch

ID   AB259049; SV 1; linear; mRNA; STD; MUS; 6510 BP.
XX
AC   AB259049;
XX
DT   19-AUG-2006 (Rel. 88, Created)
DT   21-OCT-2008 (Rel. 97, Last updated, Version 3)
XX
DE   Mus musculus CaV1.2-a mRNA for voltage-dependent calcium channel splice
DE   variant 1.2-a, complete cds.
XX
KW   .
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi; Muroidea;
OC   Muridae; Murinae; Mus; Mus.
XX
RN   [1]
RP   1-6510
RA   Murakami M.;
RT   ;
RL   Submitted (03-MAY-2006) to the INSDC.
RL   Manabu Murakami, Akita University School of Medicine, Deaprtment of
RL   Pharmacology; 1-1-1 Hondoh, Akita 010-8543, Japan
RL   (E-mail:mmura0123@hotmail.co.jp, Tel:81-18-884-6067, Fax:81-18-836-2603)
XX
RN   [2]
RX   DOI; 10.1016/j.yjmcc.2006.05.002.
RX   PUBMED; 16787652.
RA   Murakami M., Ohba T., Takahashi Y., Watanabe H., Miyoshi I., Nakayama S.,
RA   Ono K., Ito H., Iijima T.;
RT   "Identification of a cardiac isoform of the murine calcium channel alpha1C
RT   (Cav1.2-a) subunit and its preferential binding with the beta2 subunit";
RL   J. Mol. Cell. Cardiol. 41(1):115-125(2006).
XX
DR   MD5; e2b1efe1bf8096488f7a8bd53b1f5cbc.
DR   Ensembl-Gn; ENSMUSG00000051331; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000078320; mus_musculus.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..6510
FT                   /organism="Mus musculus"
FT                   /mol_type="mRNA"
FT                   /tissue_type="heart"
FT                   /db_xref="taxon:10090"
FT   CDS             1..6510
FT                   /gene="CaV1.2-a"
FT                   /product="voltage-dependent calcium channel splice variant
FT                   1.2-a"
FT                   /db_xref="GOA:Q0PCR6"
FT                   /db_xref="InterPro:IPR002077"
FT                   /db_xref="InterPro:IPR005446"
FT                   /db_xref="InterPro:IPR005451"
FT                   /db_xref="InterPro:IPR005821"
FT                   /db_xref="InterPro:IPR014873"
FT                   /db_xref="InterPro:IPR027359"
FT                   /db_xref="MGI:MGI:103013"
FT                   /db_xref="UniProtKB/TrEMBL:Q0PCR6"
FT                   /protein_id="BAF03165.1"
FT                   /translation="MIRAFVQPSTPPYQPLSSHSSEETERKFKGKVVHEAQLNCFYISP
FT                   GGSNYGSPRPAHANMNANAAAGLAPEHIPTPGAALSWQAAIDAARQAKLMGSAGNATIS
FT                   TVSSTQRKRQQYGKPKKQGGTTATRPPRALLCLTLKNPIRRACISIVEWKPFEIIILLT
FT                   IFANCVALAIYIPFPEDDSNATNSNLERVEYLFLIIFTVEAFLKVIAYGLLFHPNAYLR
FT                   NGWNLLDFIIVVVGLFSAILEQATKADGANALGGKGAGFDVKALRAFRVLRPLRLVSGV
FT                   PSLQVVLNSIIKAMVPLLHIALLVLFVIIIYAIIGLELFMGKMHKTCYNQEGIIDVPAE
FT                   EDPSPCALETGHGRQCQNGTVCKPGWDGPKHGITNFDNFAFAMLTVFQCITMEGWTDVL
FT                   YWMQDAMGYELPWVYFVSLVIFGSFFVLNLVLGVLSGEFSKEREKAKARGDFQKLREKQ
FT                   QLEEDLKGYLDWITQAEDIDPENEDEGMDEDKPRNMSMPTSETESVNTENVAGGDIEGE
FT                   NCGARLAHRISKSKFSRYWRRWNRFCRRKCRAAVKSNVFYWLVIFLVFLNTLTIASEHY
FT                   NQPHWLTEVQDTANKALLALFTAEMLLKMYSLGLQAYFVSLFNRFDCFIVCGGILETIL
FT                   VETKIMSPLGISVLRCVRLLRIFKITRYWNSLSNLVASLLNSVRSIASLLLLLFLFIII
FT                   FSLLGMQLFGGKFNFDEMQTRRSTFDNFPQSLLTVFQILTGEDWNSVMYDGIMAYGGPS
FT                   FPGMLVCIYFIILFICGNYILLNVFLAIAVDNLADAESLTSAQKEEEEEKERKKLARTA
FT                   SPEKKQEVMEKPAVEESKEEKIELKSITADGESPPTTKINMDDLQPSENEDKSPHSNPD
FT                   TAGEEDEEEPEMPVGPRPRPLSELHLKEKAVPMPEASAFFIFSPNNRFRLQCHRIVNDT
FT                   IFTNLILFFILLSSISLAAEDPVQHTSFRNHILGNADYVFTSIFTLEIILKMTAYGAFL
FT                   HKGSFCRNYFNILDLLVVSVSLISFGIQSSAINVVKILRVLRVLRPLRAINRAKGLKHV
FT                   VQCVFVAIRTIGNIVIVTTLLQFMFACIGVQLFKGKLYTCSDSSKQTEAECKGNYITYK
FT                   DGEVDHPIIQPRSWENSKFDFDNVLAAMMALFTVSTFEGWPELLYRSIDSHTEDKGPIY
FT                   NYRVEISIFFIIYIIIIAFFMMNIFVGFVIVTFQEQGEQEYKNCELDKNQRQCVEYALK
FT                   ARPLRRYIPKNQHQYKVWYVVNSTYFEYLMFVLILLNTICLAMQHYGQSCLFKIAMNIL
FT                   NMLFTGLFTVEMILKLIAFKPKGYFSDPWNVFDFLIVIGSIIDVILSETNPAEHTQCSP
FT                   SMSAEENSRISITFFRLFRVMRLVKLLSRGEGIRTLLWTFIKSFQALPYVALLIVMLFF
FT                   IYAVIGMQVFGKIALNDTTEINRNNNFQTFPQAVLLLFRCATGEAWQDIMLACMPGKKC
FT                   APESEPSNSTEGETPCGSSFAVFYFISFYMLCAFLIINLFVAVIMDNFDYLTRDWSILG
FT                   PHHLDEFKRIWAEYDPEAKGRIKHLDVVTLLRRIQPPLGFGKLCPHRVACKRLVSMNMP
FT                   LNSDGTVMFNATLFALVRTALRIKTEGNLEQANEELRAIIKKIWKRTSMKLLDQVVPPA
FT                   GDDEVTVGKFYATFLIQEYFRKFKKRKEQGLVGKPSQRNALSLQAGLRTLHDIGPEIRR
FT                   AISGDLTAEEELDKAMKEAVSAASEDDIFRRAGGLFGNHVTYYQSDSRGNFPQTFATQR
FT                   PLHINKTGNNQADTESPSHEKLVDSTFTPSSYSSTGSNANINNANNTALGRFPHPAGYS
FT                   STVSTVEGHGPPLSPAVRVQEAAWKLSSKRCHSRESQGATVNQEIFPDETRSVRMSEEA
FT                   EYCSEPSLLSTDMFSYQEDEHRQLTCPEEDKREIQPSPKRSFLRSASLGRRASFHLECL
FT                   KRQKDQGGDISQKTALPLHLVHHQALAVAGLSPLLQRSHSPTTFPRPCPTPPVTPGSRG
FT                   RPLRPIPTLRLEGAESSEKLNSSFPSIHCSSWSEETTACSGSSSMARRARPVSLTVPSQ
FT                   AGAPGRQFHGSASSLVEAVLISEGLGQFAQDPKFIEVTTQELADACDMTIEEMENAADN
FT                   ILSGGAQQSPNGTLLPFVNCRDPGQDRAVAPEDESCAYALGRGRSEEALADSRSYVSNL
FT                   "
XX
SQ   Sequence 6510 BP; 1553 A; 1828 C; 1679 G; 1450 T; 0 other;
     atgattcggg cctttgttca gccatccaca cccccatacc agccactctc cagtcactcg        60
     tctgaggaaa cagagaggaa gttcaagggc aaggtggtac atgaagctca actcaactgt       120
     ttctacattt ctcctggagg ttccaactat gggagcccac gcccagctca tgccaacatg       180
     aatgccaatg cagctgcagg acttgctccc gagcacatcc ctactccagg ggcagcactg       240
     tcctggcagg cagccatcga tgccgcccgg caggccaagc tcatgggcag tgctggcaac       300
     gcaaccatct ctaccgtcag ttccacacag cggaagcggc agcagtatgg gaaacccaag       360
     aagcaggggg gcacaaccgc cacacggccg ccccgggctc tgctgtgtct gaccctgaag       420
     aaccctatcc ggagggcgtg cataagcatt gttgaatgga aaccatttga aatcattatt       480
     ttactgacta tttttgccaa ttgtgtggcc ttagcaatct atattccctt tccggaagac       540
     gactccaacg ccaccaactc caacctggaa cgagtggagt atctcttcct catcattttt       600
     accgtggaag catttttaaa agtaattgcc tacggacttc tcttccaccc caacgcttac       660
     ctccgcaatg gttggaattt actggatttt ataatcgtgg ttgtagggct ttttagtgca       720
     attttagaac aagcaaccaa agctgatggg gccaatgctc taggagggaa aggagctgga       780
     ttcgacgtga aggcactgag agcgttccgc gtgctccgtc cactgcggct agtgtccgga       840
     gtcccaagtc tccaggtggt cctgaactcc atcatcaagg ccatggtgcc tctgctgcac       900
     attgcccttc ttgtgctctt cgtcatcatc atttatgcta ttatcggcct ggagctcttc       960
     atgggaaaga tgcacaagac ctgctacaac caggagggca taatagatgt tccggcagaa      1020
     gaggatcctt ccccttgtgc tttggagaca ggccatgggc gacagtgtca gaacgggacc      1080
     gtgtgcaaac ccgggtggga tgggcccaag cacggcatca ccaacttcga caacttcgcc      1140
     ttcgccatgc tgacggtgtt ccagtgtatc accatggagg gctggacaga cgtgctgtac      1200
     tggatgcaag acgctatggg ctatgagttg ccctgggtgt attttgtcag tctggtcatc      1260
     tttggatcct ttttcgttct aaatctggtt ctcggtgttt tgagcgggga gttttccaaa      1320
     gagagggaga aagccaaagc ccgaggagat ttccagaagc ttcgagagaa gcagcaacta      1380
     gaagaagatc tcaaaggcta cctggactgg atcacccagg cagaagacat tgaccccgag      1440
     aatgaggacg agggcatgga tgaagacaag cctcgaaaca tgagcatgcc cacaagtgag      1500
     actgagtctg tcaacactga aaacgtggct ggaggtgaca tcgagggaga aaactgtgga      1560
     gccaggcttg cccatcggat ctccaaatcc aaattcagcc gctactggcg caggtggaat      1620
     cgattctgca gaagaaaatg ccgtgcagca gttaagtcca acgtcttcta ctggctcgtg      1680
     atcttcctgg tgttcctcaa caccctcacc attgcctccg aacattacaa ccagcctcac      1740
     tggctcacag aagtgcaaga cacagccaat aaagccctcc tggccctttt cactgcagaa      1800
     atgctcctga agatgtacag cctgggtctt caggcctatt ttgtgtccct cttcaaccgc      1860
     tttgactgtt tcattgtgtg tgggggcatc ctggagacca tcctggtgga gacgaagatc      1920
     atgtctcccc tgggcatctc tgtgctgaga tgtgtgcggt tgctcaggat cttcaagatc      1980
     accaggtact ggaattcctt gagcaacctt gtggcatcct tgctgaactc agtgcgctcc      2040
     attgcctccc tgctgctgct cctcttcctc ttcatcatca tcttctccct cctggggatg      2100
     cagctctttg gagggaagtt caatttcgat gagatgcaga cccgtaggag cacgttcgat      2160
     aacttcccgc agtctctcct cactgtgttt cagatcctga ccggggagga ctggaattcg      2220
     gtgatgtatg atgggatcat ggcttatggc ggcccctctt ttccagggat gttagtctgt      2280
     atttacttca tcatcctctt catctgtgga aattatatcc tactgaatgt gttcttggcc      2340
     attgcggtgg acaacctggc tgatgcggag agcctgacct cagcccaaaa ggaggaggaa      2400
     gaagagaagg agaggaagaa gctggccagg actgccagcc cagaaaagaa acaggaggtg      2460
     atggagaagc cagccgtgga ggagagcaaa gaggagaaaa ttgaactgaa atccattaca      2520
     gccgatggag aatccccacc cactaccaag atcaacatgg atgacctcca gcccagtgaa      2580
     aacgaggata agagtcccca ctccaaccca gacactgcag gggaagagga tgaagaggag      2640
     ccagagatgc ctgtggggcc acgcccccgg cccctgtctg agctgcacct taaggaaaag      2700
     gcagttccca tgccggaagc cagtgcattt ttcatcttca gcccaaacaa caggttccgc      2760
     ctgcagtgcc accgtattgt caatgacacg atcttcacca acctcatcct cttcttcatt      2820
     ctgctcagca gcatctctct ggctgctgag gaccccgtcc agcacacctc cttcaggaac      2880
     catatcctag gcaatgcaga ctatgtcttc actagtatct ttacattaga aattatcctt      2940
     aagatgactg cttacggggc tttcctgcac aagggctctt tctgccgaaa ctacttcaat      3000
     atcctggacc tgctggtggt tagcgtgtcc ctcatctcct ttggcatcca gtccagcgcg      3060
     atcaacgttg tgaagatttt acgagtgctg cgagtcctca gacccctgag ggccatcaac      3120
     agggccaagg ggctaaagca tgtggttcag tgcgtgtttg tggccatccg gaccatcggg      3180
     aacatcgtaa ttgtcaccac tctgctgcag ttcatgttcg cctgcattgg ggtccagctc      3240
     ttcaagggaa agctctatac ctgttcggat agttctaaac agacggaggc agaatgcaag      3300
     ggtaactata tcacatacaa agatggagag gtcgatcacc ccattatcca gcctcgaagc      3360
     tgggagaaca gcaagtttga ctttgacaat gttttggcag ccatgatggc tctcttcacc      3420
     gtctccacct tcgaagggtg gccagagctg ctgtaccgct ccattgactc ccacacagaa      3480
     gacaagggcc ccatctacaa ctaccgtgtg gagatctcca tcttcttcat catctatatc      3540
     atcatcattg ccttcttcat gatgaacatc ttcgtgggtt tcgtcattgt caccttccag      3600
     gagcaggggg aacaagagta caagaactgt gagctggaca agaaccagag acaatgtgtg      3660
     gaatatgccc tcaaggcccg acccttgcga aggtacatcc ccaagaacca gcaccagtac      3720
     aaagtgtggt acgtggtcaa ctctacctac ttcgagtatc tgatgttcgt tctcatcctg      3780
     ctcaacacca tctgcctggc catgcagcac tatggccaga gctgcctctt caaaatcgcc      3840
     atgaatatac tcaacatgct tttcaccggc ctcttcacag tggagatgat cctgaagctc      3900
     attgccttca aacccaaggg ttactttagt gatccctgga atgtttttga cttcctcatc      3960
     gtcattggga gcataattga tgtcattctc agtgagacta atccagctga acatacccaa      4020
     tgctctccct ctatgagtgc agaggagaac tcccgcatct ccatcacctt cttccgcctc      4080
     ttccgggtca tgcgcctggt gaagctgctg agccgcgggg aaggcatccg aaccctgctg      4140
     tggaccttca tcaagtcctt ccaggctctg ccctatgtgg ctcttttgat tgtgatgctg      4200
     ttctttatct atgcagtgat tgggatgcag gtgtttggga agattgccct gaatgacacc      4260
     acagagatca atcggaacaa caacttccag acgttccccc aggctgtgtt actgctgttc      4320
     aggtgtgcca ccggagaggc ctggcaggac atcatgctgg cctgcatgcc aggcaagaag      4380
     tgtgccccag agtctgagcc cagcaacagc acggaagggg agaccccctg tggcagcagc      4440
     tttgctgtct tctacttcat cagcttctac atgctctgtg ccttcctgat catcaacctc      4500
     tttgtagctg ttatcatgga caactttgac tacctgacta gggattggtc tatcctcggt      4560
     ccccatcacc tggatgaatt caagagaatc tgggccgagt atgaccctga agccaagggt      4620
     cggatcaaac acttggatgt ggtgaccctc ctccgtcgaa ttcagccccc actgggtttt      4680
     gggaaattgt gtcctcaccg tgtggcctgc aaacgcctgg tgtccatgaa catgcctctg      4740
     aacagcgatg gcacagtcat gttcaatgct accctgtttg ccctcgtcag gacagccctg      4800
     aggatcaaaa cagaagggaa cctagagcaa gccaatgagg agcttcgggc catcatcaag      4860
     aaaatctgga agaggactag catgaagctg ttggaccagg tggtgccccc tgcaggcgat      4920
     gacgaggtca cagtgggcaa gttctatgcc accttcctga tccaagagta cttcaggaaa      4980
     ttcaagaagc gaaaagagca ggggctggtg ggcaagccct cacaaaggaa tgcactgtcc      5040
     ctccaggctg gcttgcgcac cttgcatgac attgggcctg agatccggcg ggccatctct      5100
     ggggatctga ctgctgagga ggagttggac aaggctatga aggaggcggt gtctgctgcc      5160
     tccgaagatg acatcttcag gagggctgga ggcctgttcg gcaaccatgt cacctactat      5220
     cagagtgaca gcaggggcaa ctttcctcag acgttcgcca cccagcgccc actgcacatc      5280
     aacaagacag ggaacaacca agctgacact gagtcaccgt cccatgagaa gctggtggac      5340
     tccacgttca cccccagcag ctactcatcc acgggctcca atgccaacat caacaatgcc      5400
     aacaacactg ccctgggccg cttcccccat cccgctggct actccagcac ggtcagcact      5460
     gtggagggcc atgggcctcc cttgtcccct gctgtccgag tacaggaggc agcatggaag      5520
     ctcagctcta agaggtgcca ctcccgagag agccagggag ccacggtgaa tcaggagata      5580
     tttccagatg agacccgcag cgtaaggatg agtgaagaag ccgagtactg cagtgagccc      5640
     agcctgctct ccacagatat gttctcctac caggaagatg aacaccgaca actgacctgc      5700
     ccagaggagg acaagaggga gatccagcca tctccaaaga ggagtttcct tcgctctgcc      5760
     tctctaggtc gaagggcctc cttccatctg gaatgtctaa agcgacaaaa ggatcaaggg      5820
     ggagacatct ctcagaagac agccttgccc ttgcatctgg ttcatcatca ggcattggca      5880
     gtggcaggct tgagccccct cctgcagaga agccattctc ctaccacatt ccccaggccg      5940
     tgccccacac cccctgtcac tccaggcagc cggggcagac ccctacggcc catccctacc      6000
     ctacggctgg agggggcaga gtccagcgag aaactcaaca gcagcttccc atccatccac      6060
     tgcagctcct ggtctgagga gacgacagcc tgtagtggga gcagcagcat ggcccggaga      6120
     gcccggcccg tctccctcac cgtgcccagc caggctggag ctccagggag acagttccat      6180
     ggcagtgcca gcagcctggt ggaagcggtc ttgatttcag aaggactggg acagtttgct      6240
     caagatccca agttcatcga ggtcaccacc caggagctgg ctgacgcctg cgacatgaca      6300
     atagaggaga tggagaacgc cgcagacaac atcctcagtg ggggcgccca gcagagcccc      6360
     aacggcaccc tcttaccttt tgtgaactgc agggacccgg ggcaggacag ggctgtggcc      6420
     ccagaggacg agagctgcgc atatgccctg gggcgaggcc ggagcgagga ggcgctcgcg      6480
     gacagcaggt cctacgtcag caacctgtag                                       6510
//


spacer
spacer