Dbfetch

ID   AB256530; SV 1; linear; genomic DNA; STD; MUS; 4007 BP.
XX
AC   AB256530;
XX
DT   02-OCT-2007 (Rel. 93, Created)
DT   02-OCT-2007 (Rel. 93, Last updated, Version 1)
XX
DE   Mus musculus Pparg gene for peroxisome proliferator-activated receptor
DE   gamma, complete cds, strain: C3H/He.
XX
KW   .
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha; Muroidea; Muridae;
OC   Murinae; Mus; Mus.
XX
RN   [1]
RP   1-4007
RA   Babaya M., Ikegami H., Fujisawa T.;
RT   ;
RL   Submitted (10-APR-2006) to the INSDC.
RL   Michiko Babaya, Osaka University Graduate School of Medicine, Department of
RL   Geriatric Medicine; 2-2 Yamadaoka, Suita, Osaka 565-0871, Japan
RL   (E-mail:mibabaya@yahoo.co.jp, Tel:81-6-6879-3852, Fax:81-6-6879-3859)
XX
RN   [2]
RA   Babaya M., Ikegami H., Fujisawa T.;
RT   "Fatty liver and obesity: phenotypically correlated but genetically
RT   distinct traits in a mouse model of type 2 diabetes";
RL   Unpublished.
XX
DR   MD5; baa3aca5646989234e2526361d447844.
DR   Ensembl-Gn; ENSMUSG00000000440; mus_musculus.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0031148; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_AJ_G0031117; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AKRJ_G0031048; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_BALBcJ_G0031128; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_C3HHeJ_G0030580; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0031587; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_CASTEiJ_G0030235; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CBAJ_G0030814; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_DBA2J_G0030967; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_FVBNJ_G0030921; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_LPJ_G0031047; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0030955; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0031614; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0029951; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_WSBEiJ_G0030319; mus_musculus_wsbeij.
DR   Ensembl-Tr; ENSMUST00000000450; mus_musculus.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0079461; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_AJ_T0079532; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AKRJ_T0079455; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_BALBcJ_T0079475; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_C3HHeJ_T0077821; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0079951; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_CASTEiJ_T0079685; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CBAJ_T0079060; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_DBA2J_T0079212; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_FVBNJ_T0079097; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_LPJ_T0079245; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0079102; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0080199; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0079112; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_WSBEiJ_T0078206; mus_musculus_wsbeij.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..4007
FT                   /organism="Mus musculus"
FT                   /chromosome="6"
FT                   /strain="C3H/He"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:10090"
FT   CDS             join(467..548,853..1080,1324..1493,1776..1914,2221..2420,
FT                   2631..3081,3253..3500)
FT                   /codon_start=1
FT                   /transl_table=1
FT                   /gene="Pparg"
FT                   /product="peroxisome proliferator-activated receptor gamma"
FT                   /db_xref="GOA:Q6GU14"
FT                   /db_xref="InterPro:IPR000536"
FT                   /db_xref="InterPro:IPR001628"
FT                   /db_xref="InterPro:IPR001723"
FT                   /db_xref="InterPro:IPR003074"
FT                   /db_xref="InterPro:IPR003077"
FT                   /db_xref="InterPro:IPR013088"
FT                   /db_xref="InterPro:IPR022590"
FT                   /db_xref="MGI:MGI:97747"
FT                   /db_xref="UniProtKB/TrEMBL:Q6GU14"
FT                   /protein_id="BAF80900.1"
FT                   /translation="MGETLGDSPVDPEHGAFADALPMSTSQEITMVDTEMPFWPTNFGI
FT                   SSVDLSVMEDHSHSFDIKPFTTVDFSSISAPHYEDIPFTRADPMVADYKYDLKLQEYQS
FT                   AIKVEPASPPYYSEKTQLYNRPHEEPSNSLMAIECRVCGDKASGFHYGVHACEGCKGFF
FT                   RRTIRLKLIYDRCDLNCRIHKKSRNKCQYCRFQKCLAVGMSHNAIRFGRMPQAEKEKLL
FT                   AEISSDIDQLNPESADLRALAKHLYDSYIKSFPLTKAKARAILTGKTTDKSPFVIYDMN
FT                   SLMMGEDKIKFKHITPLQEQSKEVAIRIFQGCQFRSVEAVQEITEYAKNIPGFINLDLN
FT                   DQVTLLKYGVHEIIYTMLASLMNKDGVLISEGQGFMTREFLKSLRKPFGDFMEPKFEFA
FT                   VKFNALELDDSDLAIFIAVIILSGDRPGLLNVKPIEDIQDNLLQALELQLKLNHPESSQ
FT                   LFAKVLQKMTDLRQIVTEHVQLLHVIKKTETDMSLHPLLQEIYKDLY"
FT   gap             702..801
FT                   /estimated_length=unknown
FT   gap             1146..1245
FT                   /estimated_length=unknown
FT   gap             1590..1689
FT                   /estimated_length=unknown
FT   gap             2046..2145
FT                   /estimated_length=unknown
FT   gap             2487..2586
FT                   /estimated_length=unknown
FT   gap             3112..3211
FT                   /estimated_length=unknown
XX
SQ   Sequence 4007 BP; 955 A; 763 C; 686 G; 1003 T; 600 other;
     ggtgtttcat aacttagaga ttaaggtttt ctattttaaa agccactggt gtgtatttta        60
     ctgcaatttt aaaaagcaat caatattgaa caatctctgc tctggtaatt ccaactactg       120
     tacagttcac gcccctcaca gaacagtgaa tgtgtgggtc actggcgaga caatgtagca       180
     acgttttcct tgtaatgtac caagtcttgc caaagcagca gacagcatta tgacacacca       240
     ttttgtcaca actggctctc agtcaggaca gtgccagcca attcaggcct gattctttct       300
     gtgtttattc ccacctctcc caaatatttg aaaactggtg tcttgactta ttagcatatt       360
     cataagctcg atgaccataa gcctttttcc tttaaccaac caatcttttg caagacatag       420
     acaaaacacc agtgtgaatt acagcaaatc tctgttttat gctgttatgg gtgaaactct       480
     gggagattct cctgttgacc cagagcatgg tgccttcgct gatgcactgc ctatgagcac       540
     ttcacaaggt aaagtccatt cctgatgttg ctgcaaggga tgcttcgggc actcatgtgt       600
     gggtgaaatt gcatgtttgt tttccacatg tattcatata gtctattaat cctttgatca       660
     tttttatggt gatcacttat aaatgtaaaa tgtattcaga annnnnnnnn nnnnnnnnnn       720
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn       780
     nnnnnnnnnn nnnnnnnnnn nctctgccct ccagaacttg actcatatcc tgttcttttt       840
     tttccacttc agaaattacc atggttgaca cagagatgcc attctggccc accaacttcg       900
     gaatcagctc tgtggacctc tccgtgatgg aagaccactc gcattccttt gacatcaagc       960
     cctttaccac agttgatttc tccagcattt ctgctccaca ctatgaagac attccattca      1020
     caagagctga cccaatggtt gctgattaca aatatgacct gaagctccaa gaataccaaa      1080
     gtatgttcac ttttcaaact actagttaga cagtttttta ataaccattg aataaatgct      1140
     cctgannnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn      1200
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnccacc atggaaagcc      1260
     acagttcctc tttaagattg tttgtcatga gataaccatc ttctcaaatt ttcccatgca      1320
     caggtgcgat caaagtagaa cctgcatctc caccttatta ttctgaaaag acccagctct      1380
     acaacaggcc tcatgaagaa ccttctaact ccctcatggc cattgagtgc cgagtctgtg      1440
     gggataaagc atcaggcttc cactatggag ttcatgcttg tgaaggatgc aaggtaaaaa      1500
     ttaaattaaa aaaaaccatc ctagagtttt ctgcaatttt gcctattcta tttcctgtta      1560
     caaactcact ctaagaattt aaagataaan nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn      1620
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn      1680
     nnnnnnnnna gtcaatgagt gtctttatcc acaggttgct gcttctatgt atcacataga      1740
     cttaaaaatt gtttattttc catatccttt tgcagggttt tttccgaaga accatccgat      1800
     tgaagcttat ttatgatagg tgtgatctta actgccggat ccacaaaaaa agtagaaata      1860
     aatgtcagta ctgtcggttt cagaagtgcc ttgctgtggg gatgtctcac aatggtaagt      1920
     ggatactgag agccatgtgt acatcttgta actctcctgg ccaatgccag gtccaggtca      1980
     gtaggcacta ggacaactaa tggaagcgag taaattcttc taaagagcat taagtttcaa      2040
     agtcannnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn      2100
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnaagat tagggagagc      2160
     acaatgcgga gccctagtaa tgatccaatg attcatcctg tcattcctct tcctctgtag      2220
     ccatcaggtt tgggcggatg ccacaggccg agaaggagaa gctgttggcg gagatctcca      2280
     gtgatatcga ccagctgaac ccagagtctg ctgatctgcg agccctggca aagcatttgt      2340
     atgactcata cataaagtcc ttcccgctga ccaaagccaa ggcgagggcg atcttgacag      2400
     gaaagacaac ggacaaatca gttagttctc ttctgctctc ttcactgggg gtggctgggg      2460
     ctgggggttg tttccttcga ctaaatnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn      2520
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn      2580
     nnnnnntctc agaacaagga actcagccac tttccctttt tcatttgcag ccatttgtca      2640
     tctacgacat gaattcctta atgatgggag aagataaaat caagttcaaa catatcaccc      2700
     ccctgcagga gcagagcaaa gaagtggcca tccgaatttt tcaagggtgc cagtttcgat      2760
     ccgtagaagc tgtgcaagag atcacagagt atgccaaaaa tatccccggt ttcattaacc      2820
     ttgacttgaa tgaccaagtg actctgctca agtatggtgt ccatgagatc atctacacga      2880
     tgctggcctc cctgatgaat aaagatggag tcctcatctc agagggccaa ggattcatga      2940
     ccagggagtt cctcaaaagc ctgcggaagc cctttggtga ctttatggag cctaagtttg      3000
     agtttgctgt gaagttcaat gcactggaat tagatgacag tgatttggct atatttatag      3060
     ctgtcattat tctcagtgga ggtaagattc atcttttgat ttttgtcaaa gnnnnnnnnn      3120
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn      3180
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn ngaggtctga caaagcctct ttttgtcttc      3240
     tcattctccc agaccgccca ggcttgctga acgtgaagcc catcgaggac atccaagaca      3300
     acctgctgca ggccctggaa ctgcagctca agctgaacca cccagagtcc tctcagctgt      3360
     tcgccaaggt gctccagaag atgacagacc tcaggcagat cgtcacagag cacgtgcagc      3420
     tactgcatgt gatcaagaag acagagacag acatgagcct tcaccccctg ctccaggaga      3480
     tctacaagga cttgtattag caggaaagtc ccacccgctg acaacgtgtt ccttctattg      3540
     attgcactat tattttgagg gaaaaaaatc tgacacctaa gaaatttact gtgaaaaagc      3600
     atttaaaaac aaaaagtttt agaacatgat ctattttatg catattgttt ataaagatac      3660
     atttacaatt tacttttaat attaaaaatt accacattat aaaattgttt atagtattta      3720
     aagaatgaat gcatgtctcc cattctgcca tcacagatgg gggaaaggat ttccccattt      3780
     tatttctttt cttctttctt ttcttcatcc tttgacatgc atatgtgctc atatatatgt      3840
     ttatgtgtga gtaggtgctg tgtatgtgta tggaggccca gagacagctc taaagctggc      3900
     tcatcctcag gactgtcatc tacccacttt tagacagggt ctttcatttg gcctaaattt      3960
     aaccaattag gttagactag agggtcagtg agccccgggg agcggcc                    4007
//