spacer

EBI Dbfetch

ID   AB256529; SV 1; linear; genomic DNA; STD; MUS; 4008 BP.
XX
AC   AB256529;
XX
DT   02-OCT-2007 (Rel. 93, Created)
DT   02-OCT-2007 (Rel. 93, Last updated, Version 1)
XX
DE   Mus musculus Pparg gene for peroxisome proliferator-activated receptor
DE   gamma, complete cds, strain: NSY.
XX
KW   .
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi; Muroidea;
OC   Muridae; Murinae; Mus; Mus.
XX
RN   [1]
RP   1-4008
RA   Babaya M., Ikegami H., Fujisawa T.;
RT   ;
RL   Submitted (10-APR-2006) to the INSDC.
RL   Michiko Babaya, Osaka University Graduate School of Medicine, Department of
RL   Geriatric Medicine; 2-2 Yamadaoka, Suita, Osaka 565-0871, Japan
RL   (E-mail:mibabaya@yahoo.co.jp, Tel:81-6-6879-3852, Fax:81-6-6879-3859)
XX
RN   [2]
RA   Babaya M., Ikegami H., Fujisawa T.;
RT   "Fatty liver and obesity: phenotypically correlated but genetically
RT   distinct traits in a mouse model of type 2 diabetes";
RL   Unpublished.
XX
DR   MD5; 944fe4187247c0878aee065483bec7b9.
DR   Ensembl-Gn; ENSMUSG00000000440; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000000450; mus_musculus.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..4008
FT                   /organism="Mus musculus"
FT                   /chromosome="6"
FT                   /strain="NSY"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:10090"
FT   CDS             join(467..548,846..1073,1325..1494,1777..1915,2222..2421,
FT                   2632..3082,3254..3501)
FT                   /codon_start=1
FT                   /transl_table=1
FT                   /gene="Pparg"
FT                   /product="peroxisome proliferator-activated receptor gamma"
FT                   /db_xref="GOA:Q6GU14"
FT                   /db_xref="InterPro:IPR000536"
FT                   /db_xref="InterPro:IPR001628"
FT                   /db_xref="InterPro:IPR001723"
FT                   /db_xref="InterPro:IPR003074"
FT                   /db_xref="InterPro:IPR003077"
FT                   /db_xref="InterPro:IPR008946"
FT                   /db_xref="InterPro:IPR013088"
FT                   /db_xref="InterPro:IPR022590"
FT                   /db_xref="MGI:MGI:97747"
FT                   /db_xref="UniProtKB/TrEMBL:Q6GU14"
FT                   /protein_id="BAF80899.1"
FT                   /translation="MGETLGDSPVDPEHGAFADALPMSTSQEITMVDTEMPFWPTNFGI
FT                   SSVDLSVMEDHSHSFDIKPFTTVDFSSISAPHYEDIPFTRADPMVADYKYDLKLQEYQS
FT                   AIKVEPASPPYYSEKTQLYNRPHEEPSNSLMAIECRVCGDKASGFHYGVHACEGCKGFF
FT                   RRTIRLKLIYDRCDLNCRIHKKSRNKCQYCRFQKCLAVGMSHNAIRFGRMPQAEKEKLL
FT                   AEISSDIDQLNPESADLRALAKHLYDSYIKSFPLTKAKARAILTGKTTDKSPFVIYDMN
FT                   SLMMGEDKIKFKHITPLQEQSKEVAIRIFQGCQFRSVEAVQEITEYAKNIPGFINLDLN
FT                   DQVTLLKYGVHEIIYTMLASLMNKDGVLISEGQGFMTREFLKSLRKPFGDFMEPKFEFA
FT                   VKFNALELDDSDLAIFIAVIILSGDRPGLLNVKPIEDIQDNLLQALELQLKLNHPESSQ
FT                   LFAKVLQKMTDLRQIVTEHVQLLHVIKKTETDMSLHPLLQEIYKDLY"
FT   gap             695..794
FT                   /estimated_length=unknown
FT   gap             1147..1246
FT                   /estimated_length=unknown
FT   gap             1591..1690
FT                   /estimated_length=unknown
FT   gap             2047..2146
FT                   /estimated_length=unknown
FT   gap             2488..2587
FT                   /estimated_length=unknown
FT   gap             3113..3212
FT                   /estimated_length=unknown
XX
SQ   Sequence 4008 BP; 954 A; 758 C; 688 G; 1008 T; 600 other;
     ggtgtttcat aacttagaga ttaaggtttt ctattttaaa agccactggt gtgtatttta        60
     ctgcaatttt aaaaagcaat caatattgaa caatctctgc tctggtaatt ccaactactg       120
     tacagttcac gcccctcaca gaacagtgaa tgtgtgggtc actggcgaga caatgtagca       180
     acgttttcct tgtaatgtac caagtcttgc caaagcagca gacagcatta tgacacacca       240
     ttttgtcaca actggctctc agtcaggaca gtgccagcca attcaggcct gattctttct       300
     gtgtttattc ccacctctcc caaatatttg aaaactggtg tcttgactta ttagcatatt       360
     cataagctcg atgaccataa gcctttttcc tttaaccaac caatcttttg caagacatag       420
     acaaaacacc agtgtgaatt acagcaaatc tctgttttat gctgttatgg gtgaaactct       480
     gggagattct cctgttgacc cagagcatgg tgccttcgct gatgcactgc ctatgagcac       540
     ttcacaaggt aaagtccatt cctgatgttg ctgcaaggga tgcttcgggc actcatgtgt       600
     gggtgaaatt gcatgtttgt tttccacatg tattcatata gtctattaat cctttgatca       660
     tttttatggt gatcacttat aaatgtattc agaannnnnn nnnnnnnnnn nnnnnnnnnn       720
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn       780
     nnnnnnnnnn nnnnctctgc cctccagaac ttgactcata tcctgttctt ttttttccac       840
     ttcagaaatt accatggttg acacagagat gccattctgg cccaccaact tcggaatcag       900
     ctctgtggac ctctccgtga tggaagacca ctcgcattcc tttgacatca agccctttac       960
     cacagttgat ttctccagca tttctgctcc acactatgaa gacattccat tcacaagagc      1020
     tgacccaatg gttgctgatt acaaatatga cctgaagctc caagaatacc aaagtatgtt      1080
     tacttttcaa actactagga ttggagttag acagtttttt aataaccatt gaataaatgc      1140
     tcctgannnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn      1200
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnccac catggaaagc      1260
     cacagttcct ctttaagatt gtttgtcatg agataaccat cttctcaaat tttcccatgc      1320
     acaggtgcga tcaaagtaga acctgcatct ccaccttatt attctgaaaa gacccagctc      1380
     tacaacaggc ctcatgaaga accttctaac tccctcatgg ccattgagtg ccgagtctgt      1440
     ggggataaag catcaggctt ccactatgga gttcatgctt gtgaaggatg caaggtaaaa      1500
     attaaattta aaaaaaccat cctagagttt tctgcaattt tgcctattct atttcctgtt      1560
     acaaactcac tctaagaatt taaagataaa nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn      1620
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn      1680
     nnnnnnnnnn agtcaatgag tgtctttatc cacaggttgc tgcttctatg tatcacatag      1740
     acttaaaaat tgtttatttt ccatatcctt ttgcagggtt ttttccgaag aaccatccga      1800
     ttgaagctta tttatgatag gtgtgatctt aactgccgga tccacaaaaa aagtagaaat      1860
     aaatgtcagt actgtcggtt tcagaagtgc cttgctgtgg ggatgtctca caatggtaag      1920
     tggatactga gagccatgtg tacatcttgt aactctcctg gccaatgcca ggtccaggtc      1980
     agtaggcact aggacaacta atggaagcga gtaaattctt ctaaagagca ttaagtttca      2040
     aagtcannnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn      2100
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnaaga ttagggagag      2160
     cacaatgcgg agccctagta atgatccaat gattcatcct gtcattcctc ttcctctgta      2220
     gccatcaggt ttgggcggat gccacaggcc gagaaggaga agctgttggc ggagatctcc      2280
     agtgatatcg accagctgaa cccagagtct gctgatctgc gagccctggc aaagcatttg      2340
     tatgactcat acataaagtc cttcccgctg accaaagcca aggcgagggc gatcttgaca      2400
     ggaaagacaa cggacaaatc agttagttct cttctgctct cttcactggg ggaggctggg      2460
     gctgggggtt gtttcctttg actaaatnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn      2520
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn      2580
     nnnnnnntct cagaacaagg aactcagcca ctttcccttt ttcatttgca gccatttgtc      2640
     atctacgaca tgaattcctt aatgatggga gaagataaaa tcaagttcaa acatatcacc      2700
     cccctgcagg agcagagcaa agaggtggcc atccgaattt ttcaagggtg ccagtttcga      2760
     tccgtagaag ccgtgcaaga gatcacagag tatgccaaaa atatccctgg tttcattaac      2820
     cttgatttga atgaccaagt gactctgctc aagtatggtg tccatgagat catctacacg      2880
     atgctggcct ccctgatgaa taaagatgga gtcctcatct cagagggcca aggattcatg      2940
     accagggagt tcctcaaaag cctgcggaag ccctttggtg actttatgga gcctaagttt      3000
     gagtttgctg tgaagttcaa tgcactggaa ttagatgaca gtgacttggc tatatttata      3060
     gctgtcatta ttctcagtgg aggtaagatt catcttttga tttttgtcaa agnnnnnnnn      3120
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn      3180
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nngaggtctg acaaagcctc tttttgtctt      3240
     ctcattctcc cagaccgccc aggcttgctg aacgtgaagc ccatcgagga catccaagac      3300
     aacctgctgc aggccctgga actgcagctc aagctgaatc acccagagtc ctctcagctg      3360
     ttcgccaagg tgctccagaa gatgacagac ctcaggcaga tcgtcacaga gcacgtgcag      3420
     ctactgcatg tgatcaagaa gacagagaca gacatgagcc ttcaccccct gctccaggag      3480
     atctacaagg acttgtatta gcaggaaagt cccacccgct gacaacgtgt tccttctatt      3540
     gattgcacta ttattttgag ggaaaaaaat ctgacaccta agaaatttac tgtgaaaaag      3600
     catttaaaaa caaaaagttt tagaacatga tctattttat gcatattgtt tataaagata      3660
     catttacaat ttacttttaa tattaaaaat taccacatta taaaattgtt tatagtattt      3720
     aaagaatgaa tgcatgtctc ccattctgcc atcacagatg ggggaaagga tttcctcatt      3780
     ttatttcttt tcttctttct tttcttcatc ctttgacatg catatgtgct catatatatg      3840
     tttatgtgtg agtagatgct gtgtatgtgt atggaggccc agagacagct ctaaagctgg      3900
     ctcattctca ggactgtcat ctacccactt ttagacaggg tctttcattt ggcctaaatt      3960
     taaccaatta ggttagacta gagggtcagt gagccccggg gaacggcc                   4008
//


spacer
spacer