Dbfetch

ID   AB232597; SV 1; linear; mRNA; STD; MUS; 627 BP.
XX
AC   AB232597;
XX
DT   15-AUG-2006 (Rel. 88, Created)
DT   23-DEC-2010 (Rel. 107, Last updated, Version 4)
XX
DE   Mus musculus Rab6B mRNA for Rab6B, complete cds.
XX
KW   .
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi; Muroidea;
OC   Muridae; Murinae; Mus; Mus.
XX
RN   [1]
RP   1-627
RA   Fukuda M.;
RT   ;
RL   Submitted (22-AUG-2005) to the INSDC.
RL   Contact:Mitsunori Fukuda Tohoku University Graduate School of Life
RL   Sciences, Laboratory of Membrane Trafficking Mechanisms, Department of
RL   Developmental Biology and Neurosciences; Aobayama, Aoba-ku, Sendai, Miyagi
RL   980-8578, Japan
XX
RN   [2]
RX   DOI; 10.1111/j.1365-2443.2006.00997.x.
RX   PUBMED; 16923123.
RA   Itoh T., Satoh M., Kanno E., Fukuda M.;
RT   "Screening for target Rabs of TBC (Tre-2/Bub2/Cdc16) domain-containing
RT   proteins based on their Rab-binding activity";
RL   Genes Cells 11(9):1023-1037(2006).
XX
RN   [3]
RX   DOI; 10.1074/jbc.M212341200.
RX   PUBMED; 12578829.
RA   Fukuda M.;
RT   "Distinct Rab binding specificity of Rim1, Rim2, rabphilin, and Noc2.
RT   Identification of a critical determinant of Rab3A/Rab27A recognition by
RT   Rim2";
RL   J Biol Chem 278(17):15373-15380(2003).
XX
RN   [4]
RX   DOI; 10.1074/jbc.C200005200.
RX   PUBMED; 11856727.
RA   Fukuda M., Kuroda T.S., Mikoshiba K.;
RT   "Slac2-a/melanophilin, the missing link between Rab27 and myosin Va:
RT   implications of a tripartite protein complex for melanosome transport";
RL   J Biol Chem 277(14):12432-12436(2002).
XX
RN   [5]
RX   DOI; 10.1074/jbc.M112414200.
RX   PUBMED; 11773082.
RA   Kuroda T.S., Fukuda M., Ariga H., Mikoshiba K.;
RT   "The Slp homology domain of synaptotagmin-like proteins 1-4 and Slac2
RT   functions as a novel Rab27A binding domain";
RL   J Biol Chem 277(11):9212-9218(2002).
XX
DR   MD5; 9e24e404b14e7317a2f0ed9ad38f6a06.
DR   Ensembl-Gn; ENSMUSG00000032549; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000035155; mus_musculus.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..627
FT                   /organism="Mus musculus"
FT                   /strain="Balb/c"
FT                   /mol_type="mRNA"
FT                   /db_xref="taxon:10090"
FT   CDS             1..627
FT                   /gene="Rab6B"
FT                   /product="Rab6B"
FT                   /db_xref="GOA:Q0PD53"
FT                   /db_xref="InterPro:IPR001806"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="MGI:MGI:107283"
FT                   /db_xref="UniProtKB/TrEMBL:Q0PD53"
FT                   /protein_id="BAF02859.1"
FT                   /translation="MSAGGDFGNPLRKFKLVFLGEQSVGKTSLITRFMYDSFDNTYQAT
FT                   IGIDFLSKTMYLEDRTVRLQLWDTAGQERFRSLIPSYIRDSTVAVVVYDITNLNSFQQT
FT                   SKWIDDVRTERGSDVIIMLVGNKTDLADKRQITIEEGEQRAKELSVMFIETSAKTGYNV
FT                   KQLFRRVASALPGMENVQEKSKEGMIDIKLDKPQEPPASEGGCSC"
XX
SQ   Sequence 627 BP; 164 A; 153 C; 186 G; 124 T; 0 other;
     atgtccgcag ggggagattt tgggaacccg ctgcgaaaat tcaagttggt tttcctaggg        60
     gagcagagcg tcgggaagac gtctctgatc acgaggttca tgtatgacag cttcgacaac       120
     acctaccagg caaccatcgg gattgacttc ttgtcaaaaa ccatgtactt ggaagaccgt       180
     acggttcgac tgcagctctg ggacactgct gggcaagaga ggttccgcag cctgatcccc       240
     agctacatcc gagactccac cgtggctgtg gtggtatatg acatcactaa tctcaactcc       300
     ttccagcaga cttctaaatg gattgatgac gtcaggacgg agaggggcag tgacgtgatc       360
     atcatgcttg tgggtaacaa gacggatctg gctgataaga ggcagataac catcgaggaa       420
     ggagaacagc gggccaaaga actgagcgtc atgttcatcg agaccagcgc gaagactggc       480
     tacaacgtga agcagctctt ccgacgtgtg gcgtcagctc tgcccggcat ggagaatgtc       540
     caggagaaga gcaaagaagg gatgattgac atcaagctgg acaagcctca ggagcccccg       600
     gccagcgagg gcggctgctc ctgttaa                                           627
//