Dbfetch

ID   AB231013; SV 1; linear; mRNA; STD; MUS; 5201 BP.
XX
AC   AB231013;
XX
DT   03-AUG-2005 (Rel. 84, Created)
DT   21-OCT-2008 (Rel. 97, Last updated, Version 3)
XX
DE   Mus musculus shank3 mRNA for Shank3, complete cds.
XX
KW   .
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha; Muroidea; Muridae;
OC   Murinae; Mus; Mus.
XX
RN   [1]
RP   1-5201
RA   Uchino S., Kohsaka S.;
RT   ;
RL   Submitted (01-AUG-2005) to the INSDC.
RL   Shigeo Uchino, National Institute of Neuroscience, Department of
RL   Neurochemistry; Ogawahigashi 4-1-1, Kodaira, Tokyo, 187-8502, Japan
RL   (E-mail:uchino@ncnp.go.jp, Tel:81-42-341-2712(ex.5232), Fax:81-42-346-1751)
XX
RN   [2]
RA   Uchino S., Wada H., Honda S., Nakamura Y., Uchiyama T., Tsutsumi M.,
RA   Hirasawa T., Kohasaka S.;
RT   "Shank3 mediates the interaction between PSD-95 and the GluR1 AMPA
RT   receptor";
RL   Unpublished.
XX
DR   MD5; 4684868fb6e626ecc795bce2ee4c3b13.
DR   Ensembl-Gn; ENSMUSG00000022623; mus_musculus.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0022239; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_AJ_G0022198; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AKRJ_G0022173; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_BALBcJ_G0022204; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_C3HHeJ_G0021974; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0022649; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_CASTEiJ_G0021496; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CBAJ_G0021941; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_DBA2J_G0022068; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_FVBNJ_G0022047; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_LPJ_G0022139; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0022067; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0022664; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0021237; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_WSBEiJ_G0021545; mus_musculus_wsbeij.
DR   Ensembl-Tr; ENSMUST00000039074; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000066545; mus_musculus.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0042261; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_AJ_T0042222; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AKRJ_T0042189; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_BALBcJ_T0042218; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_C3HHeJ_T0041952; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0042698; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_CASTEiJ_T0042034; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CBAJ_T0041859; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_DBA2J_T0042011; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_FVBNJ_T0041983; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_LPJ_T0042080; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0041951; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0042739; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0041623; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_WSBEiJ_T0041339; mus_musculus_wsbeij.
DR   EuropePMC; PMC3131048; 21558424.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..5201
FT                   /organism="Mus musculus"
FT                   /mol_type="mRNA"
FT                   /db_xref="taxon:10090"
FT   CDS             1..5193
FT                   /codon_start=1
FT                   /transl_table=1
FT                   /gene="shank3"
FT                   /product="Shank3"
FT                   /db_xref="GOA:Q4ACU6"
FT                   /db_xref="InterPro:IPR001452"
FT                   /db_xref="InterPro:IPR001478"
FT                   /db_xref="InterPro:IPR001660"
FT                   /db_xref="InterPro:IPR002110"
FT                   /db_xref="InterPro:IPR013761"
FT                   /db_xref="InterPro:IPR020683"
FT                   /db_xref="InterPro:IPR032425"
FT                   /db_xref="InterPro:IPR036028"
FT                   /db_xref="InterPro:IPR036034"
FT                   /db_xref="InterPro:IPR036770"
FT                   /db_xref="MGI:MGI:1930016"
FT                   /db_xref="PDB:3O5N"
FT                   /db_xref="PDB:5IZU"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q4ACU6"
FT                   /protein_id="BAE16756.1"
FT                   /translation="MDGPGASAVVVRVGIPDLQQTKCLRLDPTAPVWAAKQRVLCALNH
FT                   SLQDALNYGLFQPPSRGRAGKFLDEERLLQDYPPNLDTPLPYLEFRYKRRVYAQNLIDD
FT                   KQFAKLHTKANLKKFMDYVQLHSTDKVARLLDKGLDPNFHDPDSGECPLSLAAQLDNAT
FT                   DLLKVLRNGGAHLDFRTRDGLTAVHCATRQRNAGALTTLLDLGASPDYKDSRGLTPLYH
FT                   SALGGGDALCCELLLHDHAQLGTTDENGWQEIHQACRFGHVQHLEHLLFYGANMGAQNA
FT                   SGNTALHICALYNQESCARVLLFRGANKDVRNYNSQTAFQVAIIAGNFELAEVIKTHKD
FT                   SDVVPFRETPSYAKRRRLAGPSGLASPRPLQRSASDINLKGDQPAASPGPTLRSLPHQL
FT                   LLQRLQEEKDRDRDGELENDISGPSAGRGGHNKISPSGPGGSGPAPGPGPASPAPPAPP
FT                   PRGPKRKLYSAVPGRKFIAVKAHSPQGEGEIPLHRGEAVKVLSIGEGGFWEGTVKGRTG
FT                   WFPADCVEEVQMRQYDTRHETREDRTKRLFRHYTVGSYDSLTSHSDYVIDDKVAILQKR
FT                   DHEGFGFVLRGAKAETPIEEFTPTPAFPALQYLESVDVEGVAWRAGLRTGDFLIEVNGV
FT                   NVVKVGHKQVVGLIRQGGNRLVMKVVSVTRKPEEDGARRRAPPPPKRAPSTTLTLRSKS
FT                   MTAELEELASIRRRKGEKLDEILAVAAEPTLRPDIADADSRAATVKQRPTSRRITPAEI
FT                   SSLFERQGLPGPEKLPGSLRKGIPRTKSVGEDEKLASLLEGRFPRSTSMQDTVREGRGI
FT                   PPPPQTAPPPPPAPYYFDSGPPPTFSPPPPPGRAYDTVRSSFKPGLEARLGAGAAGLYD
FT                   PSTPLGPLPYPERQKRARSMIILQDSAPEVGDVPRPAPAATPPERPKRRPRPSGPDSPY
FT                   ANLGAFSASLFAPSKPQRRKSPLVKQLQVEDAQERAALAVGSPGPVGGSFAREPSPTHR
FT                   GPRPGSLDYSSGEGLGLTFGGPSPGPVKERRLEERRRSTVFLSVGAIEGSPPSADLPSL
FT                   QPSRSIDERLLGTGATTGRDLLLPSPVSALKPLVGGPSLGPSGSTFIHPLTGKPLDPSS
FT                   PLALALAARERALASQTPSRSPTPVHSPDADRPGPLFVDVQTRDSERGPLASPAFSPRS
FT                   PAWIPVPARREAEKPPREERKSPEDKKSMILSVLDTSLQRPAGLIVVHATSNGQEPSRL
FT                   GAEEERPGTPELAPAPMQAAAVAEPMPSPRAQPPGSIPADPGPGQGSSEEEPELVFAVN
FT                   LPPAQLSSSDEETREELARIGLVPPPEEFANGILLTTPPPGPGPLPTTVPSPASGKPSS
FT                   ELPPAPESAADSGVEEADTRSSSDPHLETTSTISTVSSMSTLSSESGELTDTHTSFADG
FT                   HTFLLEKPPVPPKPKLKSPLGKGPVTFRDPLLKQSSDSELMAQQHHAASTGLASAAGPA
FT                   RPRYLFQRRSKLWGDPVESRGLPGPEDDKPTVISELSSRLQQLNKDTRSLGEEPVGGLG
FT                   SLLDPAKKSPIAAARLFSSLGELSTISAQRSPGGPGGGASYSVRPSGRYPVARRAPSPV
FT                   KPASLERVEGLGAGVGGAGRPFGLTPPTILKSSSLSIPHEPKEVRFVVRSVSARSRSPS
FT                   PSPLPSPSPGSGPSAGPRRPFQQKPLQLWSKFDVGDWLESIHLGEHRDRFEDHEIEGAH
FT                   LPALTKEDFVELGVTRVGHRMNIERALRQLDGS"
XX
SQ   Sequence 5201 BP; 1007 A; 1757 C; 1564 G; 873 T; 0 other;
     atggacggac ctggggccag cgccgtggtc gtgcgcgtcg gcatcccgga cctgcaacaa        60
     acgaagtgcc tgcgtctgga cccaaccgcg cccgtgtggg ccgccaagca gcgtgtgctc       120
     tgcgccctca atcatagcct tcaagacgcg ctcaactacg ggctattcca gcctccctcc       180
     cggggtcgcg ccggcaagtt cctggatgaa gagcggctct tacaggacta cccgcctaac       240
     ctggacacgc ccctgcccta tctggagttc cgatacaagc ggagagttta tgcccagaac       300
     ctcatagatg acaagcagtt tgcaaagcta cacacaaagg caaacctgaa gaagttcatg       360
     gactatgtcc agctacacag cacagataag gtggcccgcc tgctggacaa ggggctggac       420
     cccaatttcc atgaccctga ctcaggagag tgccctctga gccttgcggc acagttggac       480
     aacgccactg acctcctgaa ggttctccgc aacggcggtg ctcatctgga cttccggacc       540
     cgagatgggc tgacagccgt ccactgtgct acccgccagc ggaacgcggg ggcattgacg       600
     accctgctgg acctgggggc ttcgcctgac tacaaggaca gccgcggcct gacgcccctg       660
     taccatagtg ccctaggggg cggggatgcc ctctgttgcg agctgcttct ccatgatcat       720
     gcacagctgg ggaccactga tgagaatggt tggcaagaga tccatcaggc ctgtcgcttt       780
     ggacacgtgc agcacctgga gcaccttttg ttctatgggg ccaacatggg tgctcagaat       840
     gcctcgggaa acacagccct gcacatctgt gccctctaca accaggagag ctgcgcgcgc       900
     gtcctgcttt tccgtggtgc caacaaggac gtccgcaatt acaacagcca gacagccttc       960
     caggtggcca ttattgcagg gaactttgag cttgccgagg taatcaagac ccacaaagac      1020
     tccgatgtcg taccattcag ggaaaccccc agctatgcaa agcgacggcg tctggctggc      1080
     ccgagtggcc tggcatcccc acggccctta cagcgctcag ccagtgatat caacctgaaa      1140
     ggtgatcagc ccgcagcttc tccagggccc actctccgaa gcctccctca tcaactcttg      1200
     ctccagaggc ttcaggagga gaaagaccgt gacagggatg gtgaactgga gaatgacatc      1260
     agcggcccct cagcaggcag gggtggccac aacaagatca gccccagtgg gcccggcgga      1320
     tccggccccg cgcccggccc cggcccggcg tctcccgcgc cccccgcgcc gccgccccgg      1380
     ggcccgaagc ggaaacttta cagtgccgtc cccggccgca agttcatcgc tgtgaaggcg      1440
     cacagcccgc agggcgaggg cgagatcccg ctgcaccgcg gcgaggccgt gaaggtgctc      1500
     agcattgggg agggcggttt ctgggaggga accgtgaagg gccgaacagg ctggttccca      1560
     gctgactgtg tggaagaagt gcagatgcga cagtatgaca cccggcatga aaccagagag      1620
     gaccggacga agcgtctctt ccgccactac actgtgggtt cctatgacag cctcacttca      1680
     cacagcgatt atgtcatcga tgataaggtg gctatcctgc agaaaaggga ccatgagggg      1740
     tttggctttg ttctccgggg agccaaagca gagaccccca ttgaggagtt tacacccaca      1800
     cctgccttcc ctgcactcca ataccttgag tctgtagatg tggaaggtgt ggcctggagg      1860
     gctggacttc gaactgggga cttcctcatt gaggtgaacg gagtgaatgt cgtgaaggtt      1920
     ggacacaagc aagtggtggg tctcatccgt cagggtggca accgcctggt catgaaggtt      1980
     gtgtctgtga ccaggaaacc cgaggaggat ggtgctcggc gcagagcccc accaccccca      2040
     aagagggctc ccagcaccac gctgaccctg cggtccaagt ccatgacggc tgagctcgag      2100
     gaacttgctt ccattcggag aagaaaaggg gagaagttgg atgagatcct ggcagttgcc      2160
     gcggagccga cactgaggcc ggacattgca gatgctgact cgagggcggc cactgtcaag      2220
     cagcggccca ccagccggag gatcacccct gctgagatca gctcattgtt tgagcgccag      2280
     ggcctcccag gcccagagaa gctgccgggc tctctgcgga aggggattcc acggaccaaa      2340
     tctgtagggg aggatgagaa gctggcatcc ctactggaag ggcgcttccc acgcagcacg      2400
     tcaatgcagg acacagtgcg tgaaggtcga ggcattccac ccccgccgca gaccgccccg      2460
     ccacccccac ccgcgcccta ctacttcgac tccgggccac cccccacctt ctcaccgccg      2520
     ccaccaccgg gccgggccta tgacactgtg cgctccagct tcaaaccagg cctggaggct      2580
     cgtctgggtg cgggggccgc cggcctgtat gatccgagca cgcctctggg cccgctgccc      2640
     taccctgagc gtcagaagcg tgcgcgctcc atgatcatac tgcaggactc tgcgccagaa      2700
     gtgggtgatg tcccccggcc tgcgcctgcc gccacaccgc ctgagcgccc caagcgccgg      2760
     cctcggccgt caggccctga tagtccctat gccaacctgg gcgccttcag tgccagcctc      2820
     ttcgctccgt cgaaaccaca gcgccgcaag agcccgctgg tgaagcagct tcaggtggag      2880
     gacgctcagg agcgcgcggc cctggccgtg ggtagcccgg gaccagtggg cggaagcttt      2940
     gcacgagaac cctctccgac gcaccgcggg ccccggccag gcagccttga ctacagctct      3000
     ggagaaggcc taggccttac cttcggcggc cctagccctg gcccagtcaa ggagcggcgc      3060
     ctggaggagc gacgccgttc cactgtgttc ctctctgtgg gtgccatcga gggcagccct      3120
     cccagcgcgg atctgccatc cctacaaccc tcccgctcca ttgatgagcg cctcctgggg      3180
     acaggcgcca ccactggccg cgatttgcta ctcccctccc ctgtctctgc tctgaagcca      3240
     ttggtcggtg gtcccagcct tgggccctca ggctccacct tcatccaccc tctcactggc      3300
     aaacccttgg atcctagctc acccttagct cttgctctgg ctgcccggga gcgggctctg      3360
     gcctcgcaaa caccttcccg gtcccccaca cctgtgcaca gccccgatgc tgaccgccct      3420
     ggacccctct ttgtggatgt gcaaacccga gactctgaga gaggaccgtt ggcttcccca      3480
     gccttctccc ctcggagtcc agcgtggatt ccagtgcctg ctcggagaga ggcagagaag      3540
     ccccctcggg aagagcggaa gtcaccagag gacaagaagt ccatgatcct cagcgtcttg      3600
     gacacgtcct tgcaacggcc agctggcctt attgttgtgc atgccaccag caatgggcag      3660
     gagcccagca ggctgggggc tgaagaggag cgccccggta ctccggagct ggccccagcc      3720
     cccatgcagg cagcagctgt ggcagagccc atgccaagcc cccgggccca gccccctggc      3780
     agcatcccag cagatcccgg gccaggtcaa ggcagctcag aggaggagcc agagctggta      3840
     ttcgctgtga acctgccacc tgctcagctg tcctccagcg atgaggagac cagagaggag      3900
     ctggcccgca tagggctagt gccaccccct gaagagtttg ccaatgggat cctgctgacc      3960
     accccgcccc cagggccggg ccccttgccc accacggtac ccagcccggc ctcagggaag      4020
     cccagcagcg agctgccccc tgcccctgag tctgcagctg actctggagt agaggaggct      4080
     gacactcgaa gctccagtga cccccacctg gagaccacaa gcaccatttc cacagtgtcc      4140
     agcatgtcca ccctgagctc ggagagtggg gaactcacgg acacccacac ctcctttgcc      4200
     gatggacaca cttttctact cgagaagcca ccagtgcctc ccaagcccaa gctcaagtcc      4260
     ccgctgggga aggggccggt gaccttcagg gacccgctgc tgaagcaatc ctcggacagt      4320
     gagctcatgg cccagcagca ccatgctgcc tctactgggt tggcttctgc tgctgggccc      4380
     gcccgccctc gctacctctt ccagagaagg tccaagctgt ggggggaccc cgtggagagt      4440
     cgggggctcc ctgggcctga agatgacaaa ccaactgtga tcagtgagct cagctcccgt      4500
     ctgcagcagc tgaataaaga cacacgctcc ttgggggagg aaccagttgg tggcctgggc      4560
     agcctgctgg accctgctaa gaagtcaccc attgcagcag ctcggctctt cagcagcctc      4620
     ggtgagctga gcaccatctc agcgcagcgc agcccggggg gcccgggcgg aggggcctcc      4680
     tactcggtgc ggcccagcgg ccggtacccc gtggcgagac gagccccgag cccagtgaaa      4740
     cccgcatcgc tggagcgggt ggaggggctg ggggcgggcg tgggaggcgc ggggcggccc      4800
     ttcggcctca cgcctcccac catcctcaag tcgtccagcc tctccatccc gcacgaaccc      4860
     aaggaagtgc gcttcgtggt gcgaagtgtg agtgcgcgca gccgctcccc ctcaccatct      4920
     ccgctgccct cgccttctcc cggctctggc cccagtgccg gcccgcgtcg gccatttcaa      4980
     cagaagcccc tgcagctctg gagcaagttc gatgtgggcg actggctgga gagcatccac      5040
     ttaggcgagc accgagaccg cttcgaggac catgagatcg aaggcgcaca cctgcctgcg      5100
     ctcaccaagg aagacttcgt ggagctgggc gtcacacgcg ttggccaccg catgaacatc      5160
     gagcgtgcgc tcaggcagct ggatggcagc tgagcggccg c                          5201
//