spacer

EBI Dbfetch

ID   AB202113; SV 1; linear; genomic DNA; STD; HUM; 6974 BP.
XX
AC   AB202113;
XX
DT   31-JAN-2006 (Rel. 86, Created)
DT   14-NOV-2006 (Rel. 89, Last updated, Version 4)
XX
DE   Homo sapiens LTA, TNF genes for lymphotoxin alpha (TNF superfamily, member
DE   1), tumor necrosis factor (TNF superfamily, member 2), complete cds.
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-6974
RA   Shiina T., Ota M., Takasu M., Katsuyama Y., Hashimoto N., Tokunaga K.,
RA   Inoko H.;
RT   ;
RL   Submitted (14-FEB-2005) to the INSDC.
RL   Miwa Takasu, Graduated School of Medicine, The University of Tokyo, Human
RL   Genetics; Hongo 7-3-1, Bunkyo-ku, Tokyo 113-0033, Japan
RL   (E-mail:mtakasu@m.u-tokyo.ac.jp, Tel:81-3-5841-3654, Fax:81-3-5802-8619)
XX
RN   [2]
RX   DOI; 10.1534/genetics.106.057034.
RX   PUBMED; 16702430.
RA   Shiina T., Ota M., Shimizu S., Katsuyama Y., Hashimoto N., Takasu M.,
RA   Anzai T., Kulski J.K., Kikkawa E., Naruse T., Kimura N., Yanagiya K.,
RA   Watanabe A., Hosomichi K., Kohara S., Iwamoto C., Umehara Y., Meyer A.,
RA   Wanner V., Sano K., Macquin C., Ikeo K., Tokunaga K., Gojobori T.,
RA   Inoko H., Bahram S.;
RT   "Rapid evolution of major histocompatibility complex class I genes in
RT   primates generates new disease alleles in humans via hitchhiking
RT   diversity";
RL   Genetics 173(3):1555-1570(2006).
XX
DR   MD5; 9f4e47bc9b29d03e45b7bdb26c4d7f85.
DR   EPD; EP11158; HS_TNF.
DR   Ensembl-Gn; ENSG00000204490; homo_sapiens.
DR   Ensembl-Gn; ENSG00000206439; homo_sapiens.
DR   Ensembl-Gn; ENSG00000223952; homo_sapiens.
DR   Ensembl-Gn; ENSG00000228321; homo_sapiens.
DR   Ensembl-Gn; ENSG00000228849; homo_sapiens.
DR   Ensembl-Gn; ENSG00000230108; homo_sapiens.
DR   Ensembl-Gn; ENSG00000232810; homo_sapiens.
DR   Ensembl-Gn; ENSG00000238130; homo_sapiens.
DR   Ensembl-Tr; ENST00000376122; homo_sapiens.
DR   Ensembl-Tr; ENST00000383303; homo_sapiens.
DR   Ensembl-Tr; ENST00000383304; homo_sapiens.
DR   Ensembl-Tr; ENST00000383496; homo_sapiens.
DR   Ensembl-Tr; ENST00000412275; homo_sapiens.
DR   Ensembl-Tr; ENST00000420425; homo_sapiens.
DR   Ensembl-Tr; ENST00000443707; homo_sapiens.
DR   Ensembl-Tr; ENST00000448781; homo_sapiens.
DR   Ensembl-Tr; ENST00000449264; homo_sapiens.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..6974
FT                   /organism="Homo sapiens"
FT                   /chromosome="6"
FT                   /map="6p21.31"
FT                   /mol_type="genomic DNA"
FT                   /haplotype="HLA-A*3303-B*4403-DRB1*1302"
FT                   /tissue_lib="JPKO"
FT                   /tissue_type="peripheral blood leukocyte"
FT                   /db_xref="taxon:9606"
FT   exon            944..1074
FT                   /gene="LTA"
FT                   /product="lymphotoxin alpha (TNF superfamily, member 1)"
FT                   /number=1
FT   exon            1362..1469
FT                   /gene="LTA"
FT                   /product="lymphotoxin alpha (TNF superfamily, member 1)"
FT                   /number=2
FT   CDS             join(1371..1469,1556..1661,1909..2321)
FT                   /codon_start=1
FT                   /transl_table=1
FT                   /gene="LTA"
FT                   /product="lymphotoxin alpha (TNF superfamily, member 1)"
FT                   /db_xref="GOA:Q5ST95"
FT                   /db_xref="InterPro:IPR002960"
FT                   /db_xref="InterPro:IPR006052"
FT                   /db_xref="InterPro:IPR006053"
FT                   /db_xref="InterPro:IPR008983"
FT                   /db_xref="InterPro:IPR021184"
FT                   /db_xref="UniProtKB/TrEMBL:Q5ST95"
FT                   /protein_id="BAE78638.1"
FT                   /translation="MTPPERLFLPRVCGTTLHLLLLGLLLVLLPGAQGLPGVGLTPSAA
FT                   QTARQHPKMHLAHSNLKPAAHLIGDPSKQNSLLWRANTDRAFLQDGFSLSNNSLLVPTS
FT                   GIYFVYSQVVFSGKAYSPKATSSPLYLAHEVQLFSSQYPFHVPLLSSQKMVYPGLQEPW
FT                   LHSMYHGAAFQLTQGDQLSTHTDGIPHLVLSPSTVFFGAFAL"
FT   exon            1556..1661
FT                   /gene="LTA"
FT                   /product="lymphotoxin alpha (TNF superfamily, member 1)"
FT                   /number=3
FT   exon            1909..2949
FT                   /gene="LTA"
FT                   /product="lymphotoxin alpha (TNF superfamily, member 1)"
FT                   /number=4
FT   exon            4201..4555
FT                   /gene="TNF"
FT                   /product="tumor necrosis factor (TNF superfamily, member
FT                   2)"
FT                   /number=1
FT   CDS             join(4370..4555,5162..5207,5395..5442,5744..6165)
FT                   /codon_start=1
FT                   /transl_table=1
FT                   /gene="TNF"
FT                   /product="tumor necrosis factor (TNF superfamily, member
FT                   2)"
FT                   /db_xref="GOA:Q5STB3"
FT                   /db_xref="InterPro:IPR002959"
FT                   /db_xref="InterPro:IPR006052"
FT                   /db_xref="InterPro:IPR006053"
FT                   /db_xref="InterPro:IPR008983"
FT                   /db_xref="InterPro:IPR021184"
FT                   /db_xref="UniProtKB/TrEMBL:Q5STB3"
FT                   /protein_id="BAE78639.1"
FT                   /translation="MSTESMIRDVELAEEALPKKTGGPQGSRRCLFLSLFSFLIVAGAT
FT                   TLFCLLHFGVIGPQREEFPRDLSLISPLAQAVRSSSRTPSDKPVAHVVANPQAEGQLQW
FT                   LNRRANALLANGVELRDNQLVVPSEGLYLIYSQVLFKGQGCPSTHVLLTHTISRIAVSY
FT                   QTKVNLLSAIKSPCQRETPEGAEAKPWYEPIYLGGVFQLEKGDRLSAEINRPDYLDFAE
FT                   SGQVYFGIIAL"
FT   exon            5162..5207
FT                   /gene="TNF"
FT                   /product="tumor necrosis factor (TNF superfamily, member
FT                   2)"
FT                   /number=2
FT   exon            5395..5442
FT                   /gene="TNF"
FT                   /product="tumor necrosis factor (TNF superfamily, member
FT                   2)"
FT                   /number=3
FT   exon            5744..6963
FT                   /gene="TNF"
FT                   /product="tumor necrosis factor (TNF superfamily, member
FT                   2)"
FT                   /number=4
XX
SQ   Sequence 6974 BP; 1644 A; 1966 C; 1835 G; 1529 T; 0 other;
     aaataatgta ttggctctgc aaatgcagct tcagaacaag tcccttagct gtccccaccc        60
     caccctaagt caccaccctt aagcctcacc catgtggaat tctgaaactt cctttgtaga       120
     aaactttgga aggtgtctgc cacattgatc ctggaatgtg tgtttatttg gggttatata       180
     aatctgttct gtggaagcca cctgaagtca ggaagagatg gagggcatcc ttcaggagtg       240
     agatgagacc tcatcatact tgactgtcca gcatcatctc tgagtaaggg gaccaaaaaa       300
     tttatcttcc aaactaggac actttcaaga gtggaagggg gatccattaa tattttcacc       360
     tggacaagag gcaaacacca gaatgtcccc gatgaagggg atatataatg gaccttcttg       420
     atgtgaaacc tgccagatgg gctggaaagt ccgtatactg ggacaagtat gatttgagtt       480
     gtttgggaca aggacagggg tacaagagaa ggaaatgggc aaagagagaa gcctgtactc       540
     agccaagggt gcagagatgt tatatatgat tgctcttcag ggaaccgggc ctccagctca       600
     caccccagct gctcaaccgc ctcctctctg aattgactgt cccttctttg gaactctagg       660
     cctgacccca ctccctggcc ctcccagccc acgattcccc tgacccgact ccctttccca       720
     gaactcagtc gcctgaaccc ccagcctgtg gttctctcct aggcctcagc ctttcctgcc       780
     tttgactgaa acagcagtat cttctaagcc ctgggggctt ccccgggccc cagccccgac       840
     ctagaacccg cccgctgcct gccacgctgc cactgccgct tcctctataa agggacctga       900
     gcgtccgggc ccaggggctc cacacagcag gtgaggctct cctgccccat ctccttgggc       960
     tgcccgtgct tcgtgctttg gactaccgcc ccgcagtgtc ctgccctctg cctgggcctc      1020
     ggtccctcct gcacctgctg cctggatccc cggcctgcct gggcctgggc cttggtgggt      1080
     ttggttttgg tttccttctc tgtctctgac tctccatctg tcagtctcat tgtctctgtc      1140
     acacattctc tgtttctgcc atggttcctc tctgttccct tcctgtctct ctctgtctcc      1200
     ctctgctcac cttggggttt ctctgactgc atcttgtccc cttctctgtc gatctctctc      1260
     tcgggggtcg gggggtgctg tctcccaggg cgggaggtct gtcttccgcc gcgtgccccg      1320
     ccccgctcac tgtctctctc tctctctctc tttctctgca ggttctcccc atgacaccac      1380
     ctgaacgtct cttcctccca agggtgtgtg gcaccaccct acacctcctc cttctggggc      1440
     tgctgctggt tctgctgcct ggggcccagg tgaggcagca ggagaatggg ggctgctggg      1500
     gtggctcagc caaaccttga gccctagagc ccccctcaac tctgttctcc cctaggggct      1560
     ccctggtgtt ggcctcacac cttcagctgc ccagactgcc cgtcagcacc ccaagatgca      1620
     tcttgcccac agcaacctca aacctgctgc tcacctcatt ggtaaacatc cacctgacct      1680
     cccagacatg tccccaccag ctctcctcct acccctgcct caggaaccca agcatccacc      1740
     cctctccccc aacttccccc acgctaaaaa aaacagaggg agcccactcc tatgcctccc      1800
     cctgccatcc cccaggaact cagttgttca gtgcccactt cctcagggat tgagacctct      1860
     gatccagacc cctgatctcc cacccccatc ccctatggct cttcctagga gaccccagca      1920
     agcagaactc actgctctgg agagcaaaca cggaccgtgc cttcctccag gatggtttct      1980
     ccttgagcaa caattctctc ctggtcccca ccagtggcat ctacttcgtc tactcccagg      2040
     tggtcttctc tgggaaagcc tactctccca aggccacctc ctccccactc tacctggccc      2100
     atgaggtcca gctcttctcc tcccagtacc ccttccatgt gcctctcctc agctcccaga      2160
     agatggtgta tccagggctg caggaaccct ggctgcactc gatgtaccac ggggctgcgt      2220
     tccagctcac ccagggagac cagctatcca cccacacaga tggcatcccc cacctagtcc      2280
     tcagccctag tactgtcttc tttggagcct tcgctctgta gaacttggaa aaatccagaa      2340
     agaaaaaata attgatttca agaccttctc cccattctgc ctccattctg accatttcag      2400
     gggtcgtcac cacctctcct ttggccattc caacagctca agtcttccct gatcaagtca      2460
     ccggagcttt caaagaagga attctaggca tcccagggga ccacacctcc ctgaaccatc      2520
     cctgatgtct gtctggctga ggatttcaag cctgcctagg aattcccagc ccaaagctgt      2580
     tggtctgtcc caccagctag gtggggccta gatccacaca cagaggaaga gcaggcacat      2640
     ggaggagctt gggggatgac tagaggcagg gaggggacta tttatgaagg caaaaaaatt      2700
     aaattattta tttatggagg atggagagag gggaataata gaagaacatc caaggagaaa      2760
     cagagacagg cccaagagat gaagagtgag agggcatgcg cacaaggctg accaagagag      2820
     aaagaagtag gcatgaggga tcacagggcc ccagaaggca gggaaaggct ctgaaagcca      2880
     gctgccgacc agagccccac acggaggcat ctgcaccctc gatgaagccc aataaacctc      2940
     ttttctctga aatgctgtct gcttgtgtgt gtgtgtctgg gagtgagaac ttcccagtct      3000
     atctaaggaa tggagggagg gacagagggc tcaaagggag caagagctgt ggggagaaca      3060
     aaaggataag ggctcagaga gcttcaggga tatgtgatgg actcaccagg tgaggccgcc      3120
     agactgctgc aggggaagca aaggagaagc tgagaagatg aaggaaaagt cagggtctgg      3180
     aggggcgggg gtcagggagc tcctgggaga tatggccaca tgtagcggct ctgaggaatg      3240
     ggttacagga gacctctggg gagatgtgac cacagcaatg ggtaggagaa tgtccagggc      3300
     tatggaagtc gagtatgggg accccccctt aacgaagaca gggccatgta gagggcccca      3360
     gggagtgaaa gagcctccag gacctccagg tatggaatac aggggacgtt taagaagata      3420
     tggccacaca ctggggccct gagaagtgag agcttcatga aaaaaatcag ggaccccaga      3480
     gttccttgga agccaagact gaaaccagca ttatgagtct ccgggtcaga atgaaagaag      3540
     aaggcctgcc ccagtggggt ctgtgaattc ccgggggtga tttcactccc cggggctgtc      3600
     ccaggcttgt ccctgctacc cccacccagc ctttcctgag gcctcaagcc tgccaccaag      3660
     cccccagctc cttctccccg cagggaccca aacacaggcc tcaggactca acacagcttt      3720
     tccctccaac cccgttttct ctccctcaag gactcagctt tctgaagccc ctcccagttc      3780
     tagttctatc tttttcctgc atcctgtctg gaagttagaa ggaaacagac cacagacctg      3840
     gtccccaaaa gaaatggagg caataggttt tgaggggcat ggggacgggg ttcagcctcc      3900
     agggtcctac acacaaatca gtcagtggcc cagaagaccc ccctcggaat cggagcaggg      3960
     aggatgggga gtgtgagggg tatccttgat gcttgtgtgt ccccaacttt ccaaatcccc      4020
     gcccccgcga tggagaagaa accgagacag aaggtgcagg gcccactacc gcttcctcca      4080
     gatgagctca tgggtttctc caccaaggaa gttttccgct ggttgaatga ttctttcccc      4140
     gccctcctct cgccccaggg acatataaag gcagttgttg gcacacccag ccagcagacg      4200
     ctccctcagc aaggacagca gaggaccagc taagagggag agaagcaact acagaccccc      4260
     cctgaaaaca accctcagac gccacatccc ctgacaagct gccaggcagg ttctcttcct      4320
     ctcacatact gacccacggc tccaccctct ctcccctgga aaggacacca tgagcactga      4380
     aagcatgatc cgggacgtgg agctggccga ggaggcgctc cccaagaaga caggggggcc      4440
     ccagggctcc aggcggtgct tgttcctcag cctcttctcc ttcctgatcg tggcaggcgc      4500
     caccacgctc ttctgcctgc tgcactttgg agtgatcggc ccccagaggg aagaggtgag      4560
     tgcctggcca gccttcatcc actctcccac ccaaggggaa atggagacgc aagagaggga      4620
     gagagatggg atgggtgaaa gatgtgcgct gatagggagg gatggagaga aaaaaacgtg      4680
     gagaaagacg gggatgcaga aagagatgtg gcaagagatg gggaagagag agagagaaag      4740
     atggagagac aggatgtctg gcacatggaa ggtgctcact aagtgtgtat ggagtgaatg      4800
     aatgaatgaa tgaatgaaca agcagatata taaataagat atggagacag atgtggggtg      4860
     tgagaagaga gatgggggaa gaaacaagtg atatgaataa agatggtgag acagaaagag      4920
     cgggaaatat gacagctaag gagagagatg ggggagataa ggagagaaga agatagggtg      4980
     tctggcacac agaagacact cagggaaaga gctgttgaat gcctggaagg tgaatacaca      5040
     gatgaatgga gagagaaaac cagacacctc agggctaaga gcgcaggcca gacaggcagc      5100
     cagctgttcc tcctttaagg gtgactccct cgatgttaac cattctcctt ctccccaaca      5160
     gttccccagg gacctctctc taatcagccc tctggcccag gcagtcagta agtgtctcca      5220
     aacctctttc ctaattctgg gtttgggttt gggggtaggg ttagtaccgg tatggaagca      5280
     gtgggggaaa tttaaagttt tggtcttggg ggaggatgga tggaggtgaa agtagggggg      5340
     tattttctag gaagtttaag ggtctcagct ttttcttttc tctctcctct tcaggatcat      5400
     cttctcgaac cccgagtgac aagcctgtag cccatgttgt aggtaagagc tctgaggatg      5460
     tgtcttggaa cttggagggc taggatttgg ggattgaagc ccggctgatg gtaggcagaa      5520
     cttggagaca atgtgagaag gactcgctga gctcaaggga agggtggagg aacagcacag      5580
     gccttagtgg gatactcaga acgtcatggc caggtgggat gtgggatgac agacagagag      5640
     gacaggaacc ggatgtgggg tgggcagagc tcgagggcca ggatgtggag agtgaaccga      5700
     catggccaca ctgactctcc tctccctctc tccctccctc cagcaaaccc tcaagctgag      5760
     gggcagctcc agtggctgaa ccgccgggcc aatgccctcc tggccaatgg cgtggagctg      5820
     agagataacc agctggtggt gccatcagag ggcctgtacc tcatctactc ccaggtcctc      5880
     ttcaagggcc aaggctgccc ctccacccat gtgctcctca cccacaccat cagccgcatc      5940
     gccgtctcct accagaccaa ggtcaacctc ctctctgcca tcaagagccc ctgccagagg      6000
     gagaccccag agggggctga ggccaagccc tggtatgagc ccatctatct gggaggggtc      6060
     ttccagctgg agaagggtga ccgactcagc gctgagatca atcggcccga ctatctcgac      6120
     tttgccgagt ctgggcaggt ctactttggg atcattgccc tgtgaggagg acgaacatcc      6180
     aaccttccca aacgcctccc ctgccccaat ccctttatta ccccctcctt cagacaccct      6240
     caacctcttc tggctcaaaa agagaattgg gggcttaggg tcggaaccca agcttagaac      6300
     tttaagcaac aagaccacca cttcgaaacc tgggattcag gaatgtgtgg cctgcacagt      6360
     gaagtgctgg caaccactaa gaattcaaac tggggcctcc agaactcact ggggcctaca      6420
     gctttgatcc ctgacatctg gaatctggag accagggagc ctttggttct ggccagaatg      6480
     ctgcaggact tgagaagacc tcacctagaa attgacacaa gtggacctta ggccttcctc      6540
     tctccagatg tttccagact tccttgagac acggagccca gccctcccca tggagccagc      6600
     tccctctatt tatgtttgca cttgtgatta tttattattt atttattatt tatttattta      6660
     cagatgaatg tatttatttg ggagaccggg gtatcctggg ggacccaatg taggagctgc      6720
     cttggctcag acatgttttc cgtgaaaacg gagctgaaca ataggctgtt cccatgtagc      6780
     cccctggcct ctgtgccttc ttttgattat gttttttaaa atatttatct gattaagttg      6840
     tctaaacaat gctgatttgg tgaccaactg tcactcattg ctgagcctct gctccccagg      6900
     ggagttgtgt ctgtaatcgc cctactattc agtggcgaga aataaagttt gcttagaaaa      6960
     gaaacatggt ctcc                                                        6974
//


spacer
spacer