spacer

EBI Dbfetch

ID   AB196836; SV 1; linear; mRNA; STD; MUS; 996 BP.
XX
AC   AB196836;
XX
DT   20-JUN-2006 (Rel. 88, Created)
DT   23-SEP-2008 (Rel. 97, Last updated, Version 2)
XX
DE   Mus musculus Ly108s mRNA for Ly108s, complete cds, strain: MRL/MpJ.
XX
KW   .
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi; Muroidea;
OC   Muridae; Murinae; Mus; Mus.
XX
RN   [1]
RP   1-996
RA   Furukawa H., Ono M.;
RT   ;
RL   Submitted (17-DEC-2004) to the INSDC.
RL   Hiroshi Furukawa, Tohoku University, Department of Pathology; Aoba-ku,
RL   Seiryo-machi 2-1, Sendai, Miyagi 980-8575, Japan
RL   (E-mail:hfurukawa@mail.tains.tohoku.ac.jp, Tel:81-22-717-8048,
RL   Fax:81-22-717-8053)
XX
RN   [2]
RA   Furukawa H., Ono M.;
RT   "Polymorphisms of SLAM family receptor genes";
RL   Unpublished.
XX
DR   MD5; bae546de640e10096ce6ce9900c8f257.
DR   Ensembl-Gn; ENSMUSG00000015314; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000171330; mus_musculus.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..996
FT                   /organism="Mus musculus"
FT                   /strain="MRL/MpJ"
FT                   /mol_type="mRNA"
FT                   /db_xref="taxon:10090"
FT   CDS             1..996
FT                   /codon_start=1
FT                   /transl_table=1
FT                   /gene="Ly108s"
FT                   /product="Ly108s"
FT                   /db_xref="GOA:Q18PG5"
FT                   /db_xref="InterPro:IPR003599"
FT                   /db_xref="InterPro:IPR007110"
FT                   /db_xref="InterPro:IPR013106"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR015631"
FT                   /db_xref="MGI:MGI:1353620"
FT                   /db_xref="UniProtKB/TrEMBL:Q18PG5"
FT                   /protein_id="BAE96339.1"
FT                   /translation="MAVSRAPAPDSACQRMVWLFPLVFCLGSGSEVSQSSSDPQLMNGV
FT                   LGESAVLPLKLPAGKIANIIIWNYEWEASQVTALVINLSNPESPQIMNTDVKKRLNITQ
FT                   SYSLQISNLTMADTGSYTAQITTKDSEVITFKYILRVFERLGNLETTNYTLLLENGTCQ
FT                   IHLACVLKNQSQTVSVEWQATGNISLGGPNVTIFWDPRNSGDQTYVCRAKNAVSNLSVS
FT                   VSTQSLCKGVLTNPPWNAVWFMTTISIISAVILIFVCWSIHVWKRRGSLPLTSQHPESS
FT                   QSTDGPGSPGNTVYAQVTRPMQEMKIPKPIKNDSMTIYSIVNHSREAEYS"
XX
SQ   Sequence 996 BP; 289 A; 250 C; 209 G; 248 T; 0 other;
     atggctgtct caagggctcc agcacccgac tccgcctgtc agaggatggt ctggctcttt        60
     ccacttgtct tctgcctcgg ctcagggagt gaagtttcac agagcagctc agacccccag       120
     ctaatgaatg gcgttctagg agagtctgca gttcttcctc taaagcttcc tgcagggaag       180
     atagccaata tcatcatctg gaattatgaa tgggaagcgt cacaagtcac tgccctcgtt       240
     atcaacctaa gtaatcctga aagtccacaa atcatgaaca ctgatgtaaa gaagagactg       300
     aacatcaccc agtcctactc cctgcaaatc agcaacctta ccatggcaga cacaggatca       360
     tacactgcgc agataaccac aaaggactct gaagtgatca ccttcaaata tattctgagg       420
     gtctttgaac gattgggtaa cttagaaact accaactata ctctcctgct agagaatggg       480
     acctgccaga tacacctggc ctgtgttttg aagaatcaaa gtcaaactgt ctcagttgag       540
     tggcaagcca caggaaacat ctctttagga ggaccaaatg tcactatctt ttgggacccg       600
     aggaattctg gtgaccagac ttacgtctgc agagccaaga atgctgtcag caatttgtca       660
     gtctctgttt cgacccagag tctctgcaaa ggggttctaa ctaatccacc ctggaatgca       720
     gtatggttta tgactacaat ttcaataatc agtgcagtca tactcatctt tgtgtgctgg       780
     agcatacatg tttggaagag aagaggttct cttcctttga ctagccaaca tccagagtcc       840
     tcccagagca cagatggccc aggctctcca gggaacactg tgtatgcaca agtcactcgt       900
     ccaatgcagg aaatgaaaat cccaaaacct atcaaaaatg actccatgac aatttactcc       960
     atagttaatc attccagaga ggctgaatac tcttaa                                 996
//


spacer
spacer