Dbfetch

ID   AB093249; SV 2; linear; mRNA; STD; MUS; 5783 BP.
XX
AC   AB093249;
XX
DT   04-DEC-2002 (Rel. 74, Created)
DT   07-OCT-2008 (Rel. 97, Last updated, Version 5)
XX
DE   Mus musculus mRNA for mKIAA0578 protein.
XX
KW   FLI_CDNA.
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha; Muroidea; Muridae;
OC   Murinae; Mus; Mus.
XX
RN   [1]
RP   1-5783
RA   Okazaki N., Kikuno R., Nagase T., Ohara O., Koga H.;
RT   ;
RL   Submitted (04-OCT-2002) to the INSDC.
RL   Hisashi Koga, Kazusa DNA Research Institute, Laboratory for Genome
RL   Informatics; 2-6-7   Kazusa-kamatari, Kisarazu, Chiba 292-0818, Japan
RL   (E-mail:mouse@kazusa.or.jp, Tel:81-438-52-3919, Fax:81-438-52-3918)
XX
RN   [2]
RA   Okazaki N., Kikuno R., Ohara R., Inamoto S., Hara Y., Nagase T., Ohara O.,
RA   Koga H.;
RT   "Prediction of the coding sequences of mouse homologues of KIAA gene: I.
RT   The complete nucleotide sequences of 100 mouse KIAA-homologous cDNAs
RT   identified by screening of terminal sequences of cDNA clones randomly
RT   sampled from size-fractionated libraries.";
RL   Unpublished.
XX
DR   MD5; d17c7ff359599c5e073be300e113474d.
DR   Ensembl-Gn; ENSMUSG00000024109; mus_musculus.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0024115; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_AJ_G0024075; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AKRJ_G0024044; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_BALBcJ_G0024076; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_C3HHeJ_G0023841; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0024521; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_CASTEiJ_G0023320; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CBAJ_G0023814; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_DBA2J_G0023943; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_FVBNJ_G0023909; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_LPJ_G0024027; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0023937; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0024566; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0023065; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_WSBEiJ_G0023386; mus_musculus_wsbeij.
DR   Ensembl-Tr; ENSMUST00000054059; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000072671; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000160844; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000161402; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000174331; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000197268; mus_musculus.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0048807; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_AJ_T0048784; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AKRJ_T0048744; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_BALBcJ_T0048746; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_C3HHeJ_T0048489; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0049238; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_CASTEiJ_T0048570; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CBAJ_T0048416; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_DBA2J_T0048518; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_FVBNJ_T0048487; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_LPJ_T0048635; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0048491; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0049338; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0048169; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_WSBEiJ_T0047792; mus_musculus_wsbeij.
XX
CC   The CREATE program supported by Japan science and technology
CC   corporation; cDNA full insert sequencing: Kazusa DNA Research
CC   Institute; cDNA library construction, clone selection and 5'- &
CC   3'-end one pass sequencing.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..5783
FT                   /organism="Mus musculus"
FT                   /mol_type="mRNA"
FT                   /dev_stage="adult"
FT                   /clone="mbg00030"
FT                   /tissue_type="brain"
FT                   /note="vector:modified pBC SK+"
FT                   /db_xref="taxon:10090"
FT   CDS             <946..5607
FT                   /codon_start=1
FT                   /gene="mKIAA0578"
FT                   /product="mKIAA0578 protein"
FT                   /note="CDS is predicted by in silico analysis. Start codon
FT                   is not identified."
FT                   /db_xref="GOA:Q9CS84"
FT                   /db_xref="InterPro:IPR000152"
FT                   /db_xref="InterPro:IPR000742"
FT                   /db_xref="InterPro:IPR001791"
FT                   /db_xref="InterPro:IPR003585"
FT                   /db_xref="InterPro:IPR013320"
FT                   /db_xref="InterPro:IPR027789"
FT                   /db_xref="InterPro:IPR029824"
FT                   /db_xref="MGI:MGI:1096391"
FT                   /db_xref="PDB:3BOD"
FT                   /db_xref="PDB:3MW2"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9CS84"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="BAC41433.2"
FT                   /translation="RRVRPSHCRLPPPSHSSADPHFSVKVSRTASTLSPPAPPRRTPAP
FT                   SMGTALVQRGGCCLLCLSLLLLGCWAELGSGLEFPGAEGQWTRFPKWNACCESEMSFQL
FT                   KTRSARGLVLYFDDEGFCDFLELILTRGGRLQLSFSIFCAEPATLLADTPVNDGAWHSV
FT                   RIRRQFRNTTLYIDRAEAKWVEVKSKRRDMTVFSGLFVGGLPPELRAAALKLTLASVRE
FT                   REPFKGWIRDVRVNSSQALPVDGGEVKLDDEPPNSGGGSPCEAGEEGEGGVCLNGGVCS
FT                   VVDDQAVCDCSRTGFRGKDCSQEDNNVEGLAHLMMGDQGKSKGKEEYIATFKGSEYFCY
FT                   DLSQNPIQSSSDEITLSFKTLQRNGLMLHTGKSADYVNLALKNGAVSLVINLGSGAFEA
FT                   LVEPVNGKFNDNAWHDVKVTRNLRQHSGIGHAMVTISVDGILTTTGYTQEDYTMLGSDD
FT                   FFYVGGSPSTADLPGSPVSNNFMGCLKEVVYKNNDVRLELSRLAKQGDPKMKIHGVVAF
FT                   KCENVATLDPITFETPESFISLPKWNAKKTGSISFDFRTTEPNGLILFSHGKPRHQKDA
FT                   KHPQMIKVDFFAIEMLDGHLYLLLDMGSGTIKIKALQKKVNDGEWYHVDFQRDGRSGTI
FT                   SVNTLRTPYTAPGESEILDLDDELYLGGLPENKAGLVFPTEVWTALLNYGYVGCIRDLF
FT                   IDGQSKDIRQMAEIQSTAGVKPSCSKETAKPCLSNPCKNNGMCRDGWNRYVCDCSGTGY
FT                   LGRSCEREATVLSYDGSMFMKIQLPVVMHTEAEDVSLRFRSQRAYGILMATTSRDSADT
FT                   LRLELDAGRVKLTVNLDCIRINCNSSKGPETLFAGYNLNDNEWHTVRVVRRGKSLKLTV
FT                   DDQQAMTGQMAGDHTRLEFHNIETGIITERRYLSSVPSNFIGHLQSLTFNGMAYIDLCK
FT                   NGDIDYCELNARFGFRNIIADPVTFKTKSSYVALATLQAYTSMHLFFQFKTTSLDGLIL
FT                   YNSGDGNDFIVVELVKGYLHYVFDLGNGANLIKGSSNKPLNDNQWHNVMISRDTSNLHT
FT                   VKIDTKITTQITAGARNLDLKSDLYIGGVAKETYKSLPKLVHAKEGFQGCLASVDLNGR
FT                   LPDLISDALFCNGQIERGCEGPSTTCQEDSCSNQGVCLQQWDGFSCDCSMTSFSGPLCN
FT                   DPGTTYIFSKGGGQITYKWPPNDRPSTRADRLAIGFSTVQKEAVLVRVDSSSGLGDYLE
FT                   LHIHQGKIGVKFNVGTDDIAIEESNAIINDGKYHVVRFTRSGGNATLQVDSWPVIERYP
FT                   AGNNDNERLAIARQRIPYRLGRVVDEWLLDKGRQLTIFNSQATIIIGGKEQGQPFQGQL
FT                   SGLYYNGLKVLNMAAENDANIAIVGNVRLVGEVPSSMTTESTATAMQSEMSTSIMETTT
FT                   TLATSTARRGKPPTKEPISQTTDDILVASAECPSDDEDIDPCEPSSGGLANPTRVGGRE
FT                   PYPGSAEVIRESSSTTGMVVGIVAAAALCILILLYAMYKYRNRDEGSYHVDESRNYISN
FT                   SAQSNGAVVKEKQPSSAKSANKNKKNKDKEYYV"
XX
SQ   Sequence 5783 BP; 1504 A; 1468 C; 1508 G; 1303 T; 0 other;
     cctttttccc tctcctcctc ctgctccccc tgctgctcct ctctgttcca tgttcttccc        60
     ttcctcactc ttggagatag acgctcaagc ctgacgcctc ggaaaaaggc agcagcagtc       120
     gccttatcct tagacctcag gaaattcgct tttaccgatg catgcttcag gttctggctc       180
     gagctaaggg gaataaccag gcagatttct gagttcttat aaacgtcaaa ataaaatcaa       240
     aatgcatcac caacatacaa ccaactgaca tgctggagtc ttagggtggc cttgcagaga       300
     cagaaaaaag aagagtttga gggattgatt tcaccatcta acagcttctg gctacttcac       360
     agcagggttt gagacctacc tacagggctc ctaaacataa agcgaatcag cctgggaggg       420
     catgcacagg aaatttggcc ttggctttag tggtgctgga agcccatgat atgacagaag       480
     taggcctctg aagctattct ggtgtctcac tctgtccttt ctccttctgt gcttggagcc       540
     aacatctgga ggggcctcga ggcctgccaa gcagccaaag atcctggctc agtgttgact       600
     tcgtgttcct ctccgagaaa agtgtgtttc ttccgattct gctctcctac tgctggcacc       660
     gcgccggtgg tactttgaag gttttggtcc tgggatagtt gaagtacctg ttggtgccac       720
     agatgccctc acttaaacat catcggatgc aaatggatca gtgatcgctc ttgagcctcg       780
     gtggccctct ttttcagaac gttgcctcca aagtgtatcc cccctttggc ctggaagttc       840
     tgcagctatc ccataggact ggggtctccg ctttccagtt ggaaggagac tactgggaga       900
     gaggaagggg ctgctggaag agaagaagaa ggaaaaaaga gctgaaggag ggtgcgcccc       960
     tcccactgcc gcctcccccc tccctcccac tcctctgcgg acccccattt ctctgtgaag      1020
     gtgtccagga ccgcttcgac cctgtcgccc ccggctcccc cccgccgcac cccagccccg      1080
     agcatgggga cggcgctggt ccagcgcggg ggctgctgtc tcctctgcct gtcgctgctg      1140
     ctgctgggct gctgggcaga gctgggcagc gggctggagt tcccgggcgc cgagggccag      1200
     tggacgcgct tccccaagtg gaacgcgtgc tgcgagagcg agatgagctt ccagctgaag      1260
     acgcgcagtg cccgcggcct cgtgctctac ttcgacgacg agggcttctg cgacttcctc      1320
     gagctcatcc tgacgcgcgg cggccgcctg cagctcagct tctccatctt ctgcgccgag      1380
     cccgccacgc tgttggccga cacgccggtc aacgacggcg cctggcacag cgtgcgcatc      1440
     cgccgccagt tccgcaacac cacgctctac atcgaccgcg ccgaggccaa gtgggtggag      1500
     gtcaagtcca agcgcaggga catgacggtg ttcagcgggc tcttcgtggg cggcctgcca      1560
     cccgaactgc gcgccgcggc cctcaagctc acgctggcct cggtgcgcga gcgcgagccc      1620
     ttcaagggct ggatccgtga cgtccgggtc aactcgtcac aggccctgcc ggtggacggc      1680
     ggcgaggtca agctggacga cgagcctccc aacagcggtg gcgggagccc atgcgaggcg      1740
     ggcgaagaag gcgagggcgg cgtgtgcctc aacgggggcg tgtgctccgt ggtcgacgac      1800
     caggccgtat gcgactgctc gaggaccggc ttccgtggca aggactgcag ccaagaagac      1860
     aacaatgtgg aaggtctggc acacctgatg atgggcgacc aaggtaaaag taaaggaaaa      1920
     gaagagtata ttgccacgtt caagggatct gaatacttct gctacgactt atctcaaaac      1980
     cccattcaaa gcagcagcga tgaaataact ctgtccttta aaactcttca aaggaacgga      2040
     ctgatgcttc acacagggaa atcagctgat tatgtcaatc ttgcattgaa aaatggagct      2100
     gtctctctgg tcattaattt gggatcaggg gcctttgaag cactagtgga gcctgtgaat      2160
     ggaaagttta atgataatgc ctggcatgat gtgaaagtca ccaggaatct gcgtcagcac      2220
     tcaggcattg gacacgctat ggtgacaata tcagtggatg gaattcttac cacaacgggc      2280
     tacacgcaag aagattacac catgctgggg tctgatgact ttttctatgt tggaggcagc      2340
     cccagcacag ccgaccttcc agggtcacca gtcagtaaca actttatggg ctgtctcaaa      2400
     gaggttgtat ataaaaataa tgatgtaagg ctggaattat cgcgacttgc caagcaagga      2460
     gatcctaaga tgaagattca cggtgtggtg gcttttaagt gtgaaaatgt ggcaacctta      2520
     gacccaataa cttttgagac cccggaatct ttcatttctt tgcctaagtg gaatgcaaag      2580
     aaaacaggct caatatcatt tgatttccgt acaacggagc caaatggcct catcctgttt      2640
     agccatggca agccaagaca tcagaaggat gccaagcacc cacagatgat taaggttgac      2700
     ttttttgcta ttgagatgct ggatggccac ttgtacctcc tcttagacat gggatcaggt      2760
     actataaaaa tcaaagccct gcagaagaaa gtcaatgatg gagaatggta tcacgtggat      2820
     ttccaacggg atggacggtc aggtaccatt tctgtcaaca cactacgcac tccctacaca      2880
     gctcccggtg agagtgagat cctggaccta gatgatgagt tgtacctggg tggcttgcca      2940
     gaaaataagg ctggcctagt cttccctacc gaggtgtgga ctgctctgct caactacggc      3000
     tacgtgggct gcatccggga cctatttatt gatggccaga gcaaagacat ccggcagatg      3060
     gcggaaattc agagcactgc tggagtgaag ccatcctgct caaaagagac agcaaaaccg      3120
     tgccttagca atccttgcaa aaacaatggc atgtgcagag atggctggaa cagatacgtc      3180
     tgcgattgct ccggaacagg ctatctcggc aggtcctgtg agagagaggc aacggttttg      3240
     agctacgacg ggagcatgtt catgaaaatc cagcttccgg tggtgatgca cactgaggct      3300
     gaggacgtgt ccttgcggtt ccgatcccag cgtgcatatg gtatcctgat ggcgaccact      3360
     tctagagact ctgcagacac ccttcgattg gagctagatg caggacgtgt gaaactcacg      3420
     gtcaatctag attgtatcag gattaactgt aattccagca aaggtcctga gacccttttt      3480
     gctggctata acctcaatga taatgaatgg cacacagtgc gtgtggttcg gcgaggaaaa      3540
     agtttaaagc taaccgtgga tgatcaacaa gccatgacag gccaaatggc aggtgatcat      3600
     acaaggctgg agtttcataa catagagaca ggcatcatca ccgaacgacg ctacctttct      3660
     tctgtcccct ccaatttcat tgggcacctg caaagcctga catttaatgg aatggcatac      3720
     atagacttgt gcaaaaatgg tgatatagat tactgtgaac tcaatgccag gtttggattc      3780
     aggaacatca tcgcagatcc tgtcaccttc aagaccaaat cgagctatgt tgccttagct      3840
     acattgcaag cctacacctc tatgcatcta tttttccaat tcaagacaac atctctagat      3900
     ggactaattc tgtataacag tggggatgga aatgacttta ttgtggttga attagttaaa      3960
     gggtacttac attatgtgtt tgacttggga aacggtgcta acctcatcaa agggagctca      4020
     aacaaaccac tcaacgacaa tcagtggcac aatgtgatga tttcacggga caccagcaat      4080
     ctccacacag taaagatcga cacaaaaatc acaacacaaa tcactgcggg agccagaaat      4140
     ctagacctca agagtgactt gtatattgga ggagtggcta aagaaacata taaatccctg      4200
     ccaaaactgg tccatgccaa agaaggcttt caaggttgcc tggcatctgt ggacttgaat      4260
     ggcagacttc cagatctcat ctcggatgct ctcttctgca atgggcaaat tgagagagga      4320
     tgcgaagggc ccagcacaac ctgccaagag gattcatgtt caaatcaagg cgtttgcttg      4380
     cagcaatggg atggcttcag ctgtgactgt agcatgactt ccttcagtgg cccactctgc      4440
     aatgaccctg ggacaacata tatctttagc aaaggtggtg gacagattac atataagtgg      4500
     cctcccaatg accgccccag tacacgagca gacaggctgg ccatcggatt tagcactgtc      4560
     cagaaggaag ccgtgttggt gcgtgtggac agttcctcag gcctgggtga ctacctggag      4620
     ctgcacatac accaaggaaa aattggagtt aagtttaatg ttgggacaga tgacatcgcc      4680
     atcgaagagt ctaatgcaat cattaatgat gggaaatacc atgtagtacg tttcacaagg      4740
     agtggtggca atgccacgtt acaggtggac agctggccag ttatcgaacg ctaccctgca      4800
     ggaaacaatg ataacgagcg cctggcgatt gctagacagc gaattccata tcgacttggt      4860
     cgagtagttg atgaatggct actcgacaaa gggcgtcagc tcacaatctt caatagccaa      4920
     gcaaccataa taattggcgg gaaagagcag ggccagccct tccagggcca gctctctggt      4980
     ctttactaca atggcttgaa agttctgaat atggcagcag agaacgatgc caacatcgcc      5040
     atagtgggga atgtgaggct ggtcggtgaa gtgccttcct ctatgacaac tgagtcgaca      5100
     gccactgcca tgcagtctga gatgtccacc tcaatcatgg agaccaccac aaccctggct      5160
     accagcacag ctagaagagg caagcccccc acaaaggaac ccatcagcca gaccacagat      5220
     gacatccttg tggcctcggc agagtgtccc agtgacgatg aggacattga cccctgtgag      5280
     ccgagctcag gtgggttagc caaccccacc agagtaggtg gccgtgaacc atacccaggc      5340
     tctgcagagg tgattcggga gtccagcagt accactggca tggtggtggg gattgtcgca      5400
     gcagccgctc tgtgcatcct catcctcctc tatgccatgt acaagtacag gaaccgggat      5460
     gaagggtcgt accacgtgga tgagagtcga aactacatca gtaactcagc acagtccaat      5520
     ggggctgtgg tcaaggagaa gcaacccagc agtgctaaaa gcgccaacaa aaacaagaaa      5580
     aacaaggata aggagtatta cgtctgatat caagatttga aacggacact tgtatagaaa      5640
     tagtcttcat tttatctgag acataatata aacttttact ttccttttta tgaagcacat      5700
     acaaaagaag acagggaatg cgatcaggag ggaaaactct ttttaaaaaa aaaacaaaca      5760
     agtatctcat gctcttgttt ctc                                              5783
//