spacer

EBI Dbfetch

ID   AB079073; SV 1; linear; mRNA; STD; MUS; 2709 BP.
XX
AC   AB079073;
XX
DT   05-JUL-2005 (Rel. 84, Created)
DT   23-SEP-2008 (Rel. 97, Last updated, Version 3)
XX
DE   Mus musculus mRNA for AMPA-selective glutamate receptor 4 (GluR-4) flip,
DE   complete cds.
XX
KW   .
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi; Muroidea;
OC   Muridae; Murinae; Mus; Mus.
XX
RN   [1]
RP   1-2709
RA   Nishizawa M.;
RT   ;
RL   Submitted (29-JAN-2002) to the INSDC.
RL   Contact:Mikio Nishizawa Ritsumeikan University, College of Life Sciences,
RL   Department of Biomedical Sciences; Nojihigashi 1-1-1, Kusatsu, Shiga
RL   525-8577, Japan
XX
RN   [2]
RA   Doi Y., Nishizawa M., Minami T., Ito S.;
RT   "Expression of AMPA-selective glutamate receptors in mouse spinal cord";
RL   Unpublished.
XX
DR   MD5; 5f2e1a480aa7d34d70b3e3f89e9035f7.
DR   Ensembl-Gn; ENSMUSG00000025892; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000063508; mus_musculus.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..2709
FT                   /organism="Mus musculus"
FT                   /strain="ddY"
FT                   /mol_type="mRNA"
FT                   /tissue_type="spinal cord"
FT                   /db_xref="taxon:10090"
FT   CDS             1..2709
FT                   /codon_start=1
FT                   /transl_table=1
FT                   /gene="glur-4"
FT                   /product="AMPA-selective glutamate receptor 4 (GluR-4)
FT                   flip"
FT                   /note="alternative splicing: see also Acc#:AB102777 and
FT                   AB104708"
FT                   /note="another name:GluR-4, AMPA-selective glutamate
FT                   receptor type D (GluR-D) flip"
FT                   /db_xref="GOA:Q9Z2W8"
FT                   /db_xref="InterPro:IPR001320"
FT                   /db_xref="InterPro:IPR001508"
FT                   /db_xref="InterPro:IPR001828"
FT                   /db_xref="InterPro:IPR019594"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="MGI:MGI:95811"
FT                   /protein_id="BAE06154.1"
FT                   /translation="MRIICRQIVLLFSGFWGLAMGAFPSSVQIGGLFIRNTDQEYTAFR
FT                   LAIFLHNTSPNASEAPFNLVPHVDNIETANSFAVTNAFCSQYSRGVFAIFGLYDKRSVH
FT                   TLTSFCSALHISLITPSFPTEGESQFVLQLRPSLRGALLSLLDHYEWNCFVFLYDTDRG
FT                   YSILQAIMEKAGQNGWHVSAICVENFNDVSYRQLLEELDRRQEKKFVIDCEIERLQNIL
FT                   EQIVSVGKHVKGYHYIIANLGFKDISLERFIHGGANVTGFQLVDFNTPMVTKLMDRWKK
FT                   LDQREYPGSETPPKYTSALTYDGVLVMAETFRSLRRQKIDISRRGNAGDCLANPAAPWG
FT                   QGIDMERTLKQVRIQGLTGNVQFDHYGRRVNYTMDVFELKSTGPRKVGYWNDMDKLVLI
FT                   QDAPTLGNDTAAIENRTVVVTTIMESPYVMYKKNHEMFEGNDKYEGYCVDLASEIAKHI
FT                   GIKYKIAIVPDGKYGARDADTKIWNGMVGELVYGKAEIAIAPLTITLVREEVIDFSKPF
FT                   MSLGISIMIKKPQKSKPGVFSFLDPLAYEIWMCIVFAYIGVSVVLFLVSRFSPYEWHTE
FT                   EPEDGKEGPSDQPPNEFGIFNSLWFSLGAFMQQGCDISPRSLSGRIVGGVWWFFTLIII
FT                   SSYTANLAAFLTVERMVSPIESAEDLAKQTEIAYGTLDSGSTKEFFRRSKIAVYEKMWT
FT                   YMRSAEPSVFTRTTAEGVARVRKSKGKFAFLLESTMNEYIEQRKPCDTMKVGGNLDSKG
FT                   YGVATPKGSSLRTPVNLAVLKLSEAGVLDKLKNKWWYDKGECGPKDSGSKDKTSALSLS
FT                   NVAGVFYILVGGLGLAMLVALIEFCYKSRAEAKRMKLTFSEAIRNKARLSITGSVGENG
FT                   RVLTPDCPKAVHTGTAIRQSSGLAVIASDLP"
XX
SQ   Sequence 2709 BP; 785 A; 558 C; 672 G; 694 T; 0 other;
     atgaggatta tttgcaggca gattgtcttg ttgttttctg gattttgggg actcgccatg        60
     ggagcctttc cgagcagcgt tcaaataggt ggtctcttta tccgaaacac agaccaggaa       120
     tacactgctt ttcggctagc tatctttctt cataacacca gccccaatgc atctgaagcc       180
     cctttcaatt tggtacctca tgtggacaac attgagactg ccaacagttt tgctgtgaca       240
     aatgcattct gttcccagta ttctagaggg gtgtttgcca tttttggact ctatgacaag       300
     aggtcagtgc ataccttgac ctccttctgc agtgctctgc acatctctct catcacacca       360
     agcttcccca ctgaaggaga gagtcagttc gtgcttcagc taagaccttc attgagaggt       420
     gcactcctga gcctcctgga tcactatgaa tggaattgtt ttgtcttcct gtatgataca       480
     gacagggggt attcaatact tcaagctata atggaaaaag caggacagaa tggatggcat       540
     gtcagtgcga tatgtgtgga aaattttaac gatgtcagct acaggcaact actagaagag       600
     cttgacagaa gacaagagaa gaaatttgta atagattgtg agatagaaag gcttcaaaac       660
     atattagaac aaattgtgag tgttgggaag cacgtcaaag gctaccatta tatcatcgca       720
     aatttgggtt tcaaagatat ttctcttgag agatttatac atggaggagc aaatgtcact       780
     ggattccagt tagtagattt taatacgccc atggtgacga aactaatgga tcgctggaag       840
     aaactagatc aacgagaata tccaggatct gaaacacctc caaagtacac ttctgctctc       900
     acttacgatg gtgtcttggt aatggctgaa actttccgaa gtctcagaag acagaaaatt       960
     gatatttcaa ggagaggaaa tgcaggggat tgtctggcaa accctgctgc tccctggggc      1020
     cagggaattg acatggagag aacactgaag caggttcgaa ttcaaggact gactgggaat      1080
     gttcaatttg accactatgg acgtagagtt aattacacaa tggatgtgtt tgaattaaaa      1140
     agcacaggac ctcgaaaggt tggctattgg aacgatatgg ataaattagt cttgattcaa      1200
     gatgcgccta ctcttggcaa tgacacagca gctatcgaga acagaacagt ggttgtaacc      1260
     acaattatgg aatcccccta cgttatgtac aagaaaaatc atgaaatgtt tgaaggaaat      1320
     gacaagtatg aaggctactg tgtagacttg gcatctgaaa ttgcgaaaca tatcggtatc      1380
     aaatataaaa ttgccattgt ccctgatgga aaatatggag caagggatgc ggacaccaaa      1440
     atttggaatg ggatggtagg agagcttgtg tatgggaaag cagagattgc cattgcacct      1500
     ctgacaatca cgttggtgcg agaggaggtc atcgactttt ctaagccttt tatgagttta      1560
     ggcatctcta tcatgatcaa aaaacctcag aaatctaaac caggagtgtt ttccttcttg      1620
     gaccctctgg cctatgagat ctggatgtgc atagtgtttg catacattgg tgtcagcgtg      1680
     gtcttgttcc tagtcagtag gtttagccca tatgagtggc acacagaaga gcctgaggat      1740
     ggaaaagaag gacccagtga ccaacctccc aatgagtttg gcatctttaa cagcctctgg      1800
     ttttccctgg gtgcctttat gcaacaagga tgtgacattt cacccagatc cctgtccggt      1860
     cggattgttg gaggcgtatg gtggttcttc actctcatca ttatctcatc ctacactgct      1920
     aatctggctg cattcctgac agtggagaga atggtctccc ccatagaaag tgcagaagac      1980
     ctggccaaac aaacagaaat tgcctatgga acacttgatt cgggatcaac aaaagaattc      2040
     ttcagaagat caaaaatagc agtatatgaa aagatgtgga cctacatgcg atcggcagag      2100
     ccatctgtgt tcactagaac tacagctgag ggcgtggccc gtgtccgcaa gtccaagggc      2160
     aaatttgcct tcctcctgga gtccacgatg aatgaataca ttgagcagcg aaagccctgt      2220
     gacacgatga aagtgggagg aaacctggat tccaaaggct atggtgtagc gacgcccaag      2280
     ggttcctcat taagaactcc tgtaaacctt gccgttttga aactcagtga ggcaggcgtc      2340
     ttagacaagc tgaaaaacaa atggtggtac gataaaggtg aatgtggacc caaggactcg      2400
     ggaagcaagg acaagacgag tgccttgagc ctgagcaacg tagcaggcgt cttctacatt      2460
     ctggttggcg gcttgggctt ggcaatgctg gtggctttga tagagttctg ttacaagtcc      2520
     agggcagagg cgaagagaat gaagctgact ttttccgaag ccataagaaa caaagccagg      2580
     ttatccatca ctgggagtgt gggagaaaac ggccgtgtgc tgacccccga ctgccccaag      2640
     gccgtacaca caggaactgc gattagacag agctcgggat tggctgtcat tgcatcggac      2700
     ctaccataa                                                              2709
//


spacer
spacer