spacer

EBI Dbfetch

ID   AB079072; SV 1; linear; mRNA; STD; MUS; 2667 BP.
XX
AC   AB079072;
XX
DT   05-JUL-2005 (Rel. 84, Created)
DT   23-SEP-2008 (Rel. 97, Last updated, Version 3)
XX
DE   Mus musculus mRNA for AMPA-selective glutamate receptor 3 (GluR-3) flip,
DE   complete cds.
XX
KW   .
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi; Muroidea;
OC   Muridae; Murinae; Mus; Mus.
XX
RN   [1]
RP   1-2667
RA   Nishizawa M.;
RT   ;
RL   Submitted (29-JAN-2002) to the INSDC.
RL   Contact:Mikio Nishizawa Ritsumeikan University, College of Life Sciences,
RL   Department of Biomedical Sciences; Nojihigashi 1-1-1, Kusatsu, Shiga
RL   525-8577, Japan
XX
RN   [2]
RA   Doi Y., Nishizawa M., Minami T., Ito S.;
RT   "Expression of AMPA-selective glutamate receptors in mouse spinal cord";
RL   Unpublished.
XX
DR   MD5; 85043207b8a56f4475d1375a21eaaa2f.
DR   Ensembl-Gn; ENSMUSG00000001986; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000076349; mus_musculus.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..2667
FT                   /organism="Mus musculus"
FT                   /strain="ddY"
FT                   /mol_type="mRNA"
FT                   /tissue_type="spinal cord"
FT                   /db_xref="taxon:10090"
FT   CDS             1..2667
FT                   /codon_start=1
FT                   /gene="glur-3"
FT                   /product="AMPA-selective glutamate receptor 3 (GluR-3)
FT                   flip"
FT                   /note="alternative splicing: see also Acc#:AB102775 and
FT                   AB102776"
FT                   /note="another name: AMPA-selective glutamate receptor type
FT                   C (GluR-C) flip, glutamate receptor alpha 3 flip"
FT                   /db_xref="GOA:Q9Z2W9"
FT                   /db_xref="InterPro:IPR001320"
FT                   /db_xref="InterPro:IPR001508"
FT                   /db_xref="InterPro:IPR001828"
FT                   /db_xref="InterPro:IPR019594"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="MGI:MGI:95810"
FT                   /db_xref="PDB:3LSW"
FT                   /db_xref="PDB:3LSX"
FT                   /protein_id="BAE06153.1"
FT                   /translation="MGQSVLRAVFFLVLGLLGHSHGGFPNTISIGGLFMRNTVQEHSAF
FT                   RFAVQLYNTNQNTTEKPFHLNYHVDHLDSSNSFSVTNAFCSQFSRGVYAIFGFYDQMSM
FT                   NTLTSFCGALHTSFVTPSFPTDADVQFVIQMRPALKGAILSLLGYYKWEKFVYLYDTER
FT                   GFSILQAIMEAAVQNNWQVTARSVGNIKDIQEFRRIIEEMDRRQEKRYLIDCEVERINT
FT                   ILEQVVILGKHSRGYHYMLANLGFTDIVLERVMHGGANITGFQIVNNENPMVQQFIQRW
FT                   VRLDEREFPEAKNAPLKYTSALTHDAILVIAEAFRYLRRQRVDVSRRGSAGDCLANPAV
FT                   PWSQGIDIERALKMVQVQGMTGNIQFDTYGRRTNYTIDVYEMKVSGSRKAGYWNEYERF
FT                   VPFSDQQISNDSSSSENRTIVVTTILESPYVMYKKNHEQLEGNERYEGYCVDLAYEIAK
FT                   HVRIKYKLSIVGDGKYGARDPETKIWNGMVGELVYGRADIAVAPLTITLVREEVIDFSK
FT                   PFMSLGISIMIKKPQKSKPGVFSFLDPLAYEIWMCIVFAYIGVSVVLFLVSRFSPYEWH
FT                   LEDNNEEPRDPQSPPDPPNEFGIFNSLWFSLGAFMQQGCDISPRSLSGRIVGGVWWFFT
FT                   LIIISSYTANLAAFLTVERMVSPIESAEDLAKQTEIAYGTLDSGSTKEFFRRSKIAVYE
FT                   KMWSYMKSAEPSVFTKTTADGVARVRKSKGKFAFLLESTMNEYIEQRKPCDTMKVGGNL
FT                   DSKGYGVATPKGSALGTPVNLAVLKLSEQGILDKLKNKWWYDKGECGAKDSGSKDKTSA
FT                   LSLSNVAGVFYILVGGLGLAMMVALIEFCYKSRAESKRMKLTKNTQNFKPAPATNTQNY
FT                   ATYREGYNVYGTESVKI"
XX
SQ   Sequence 2667 BP; 780 A; 566 C; 648 G; 673 T; 0 other;
     atggggcaaa gcgtgctccg ggcggtcttc tttttagtcc tggggctttt gggtcattct        60
     cacggaggat tccccaacac catcagcata ggtggacttt tcatgagaaa cacggtacag       120
     gagcacagtg ctttccgctt tgctgtgcag ttatacaaca ccaaccagaa caccactgag       180
     aagcccttcc atttgaacta ccacgtagac cacttggatt cctccaatag tttttctgtg       240
     actaatgctt tctgctccca gttctccaga ggggtgtatg ctatctttgg attctatgac       300
     cagatgtcaa tgaacacact gacctccttc tgtggggccc tgcatacatc tttcgtcaca       360
     cctagctttc ccactgatgc cgatgtgcag tttgtcatcc agatgcgccc agccttaaag       420
     ggtgccattc tgagtcttct gggttactac aagtgggaga agtttgtgta cctctatgac       480
     acagaacgag ggttttccat cctgcaagca attatggaag cagcagtgca aaacaactgg       540
     caagtgacag caaggtctgt gggaaacata aaggacatcc aggaattcag acgcatcatt       600
     gaagaaatgg acagaaggca ggaaaaacga tacttgattg actgtgaagt cgaaaggatt       660
     aacacaattt tggaacaggt tgtgatcctg gggaaacatt caagaggtta tcactacatg       720
     cttgctaacc tgggttttac tgacattgta ctggaaagag tcatgcatgg gggagccaac       780
     attacaggtt tccagattgt caacaatgaa aacccaatgg tccagcaatt catacagcgc       840
     tgggtgagac tggatgaaag ggaattccct gaagccaaga atgcaccact aaagtataca       900
     tctgcactga cacacgacgc aatactggtc atagcagaag ccttccgata cctgaggagg       960
     cagcgagtgg atgtatcccg cagaggcagt gctggagact gcttagcaaa tcctgctgtg      1020
     ccctggagtc aaggaattga tattgagaga gctctgaaaa tggtgcaagt acaaggaatg      1080
     actggaaaca tccaatttga cacttatgga cgtaggacaa attataccat tgatgtatat      1140
     gaaatgaaag tctcaggctc tcgaaaagct ggttactgga atgagtatga aaggtttgtg      1200
     cccttctcag atcaacaaat cagcaatgac agctcatcct ccgagaacag gaccatcgta      1260
     gtgactacca ttctggaatc accatatgta atgtataaaa agaatcatga gcaactggaa      1320
     ggaaatgagc gctatgaagg ctattgtgtc gatttagcct atgaaatagc caaacacgta      1380
     aggatcaaat acaaattgtc cattgtcggt gatgggaaat atggcgcaag ggatccagag      1440
     actaaaatat ggaatggcat ggttggggaa cttgtctatg gaagagctga tatagctgtt      1500
     gctccactca ctataacatt ggtccgtgaa gaagtcatag atttttcaaa gccatttatg      1560
     agcctgggga tctccatcat gataaagaag cctcagaaat caaagccagg cgtattttca      1620
     ttcctggatc ctttagctta tgaaatctgg atgtgcattg tcttcgctta cattggagtc      1680
     agtgtagttc tcttcctagt cagcagattt agcccttatg agtggcactt ggaagacaac      1740
     aatgaagaac ctcgtgaccc acaaagccct cctgatcctc ccaatgaatt tggaatattt      1800
     aacagtcttt ggttttcctt gggtgctttt atgcagcaag gatgtgatat ttctccaaga      1860
     tcactttctg ggcgcattgt tggaggggtt tggtggttct tcaccctgat cataatctct      1920
     tcctacactg caaaccttgc tgctttcctg actgtggaga ggatggtgtc ccccatagag      1980
     agcgctgaag atttagccaa gcagactgaa attgcatacg ggaccctgga ctctggttca      2040
     acaaaagaat ttttcagaag atccaaaatt gctgtgtatg agaaaatgtg gtcttacatg      2100
     aaatccgcag agccatctgt gtttaccaaa acaacagctg atggggtagc ccgagttcgg      2160
     aagtccaagg gaaagttcgc cttcctgctg gagtcaacca tgaatgagta cattgagcag      2220
     agaaagccgt gtgatacgat gaaagttggt ggaaatctgg attccaaagg ctatggtgtg      2280
     gcaaccccta aaggctcagc attaggaacg cctgtaaacc ttgcagtatt gaaactcagt      2340
     gaacaaggca tcttagacaa gctgaaaaac aaatggtggt acgataaggg ggaatgtgga      2400
     gccaaggact ccgggagtaa ggacaagacc agtgctctaa gcctgagcaa tgtggcaggc      2460
     gtgttctata tacttgtcgg aggtctgggg ctggccatga tggtggcttt gatagaattc      2520
     tgttacaaat cacgggcaga gtccaaacgc atgaaactca caaagaacac ccaaaacttt      2580
     aagcctgctc ctgccaccaa cactcagaat tacgctacat acagagaagg ctacaacgtg      2640
     tatggaacag aaagtgttaa gatctag                                          2667
//


spacer
spacer