spacer

EBI Dbfetch

ID   AB078338; SV 1; linear; mRNA; STD; MUS; 4330 BP.
XX
AC   AB078338;
XX
DT   19-JUL-2003 (Rel. 76, Created)
DT   23-SEP-2008 (Rel. 97, Last updated, Version 5)
XX
DE   Mus musculus mel1 mRNA for transcription factor MEL1, complete cds.
XX
KW   .
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi; Muroidea;
OC   Muridae; Murinae; Mus; Mus.
XX
RN   [1]
RP   1-4330
RA   Morishita K., Tateno Y., Imakura M., Sasaki H., Nishikata I.;
RT   ;
RL   Submitted (17-JAN-2002) to the INSDC.
RL   Kazuhiro Morishita, Miyazaki Medical College, Department of BIochemistry;
RL   Kihara 5200, Kiyotake, Miyazaki, Miyazaki 889-1692, Japan
RL   (E-mail:kmorishi@post.miyazaki-med.ac.jp, Tel:81-985-85-0985,
RL   Fax:81-985-85-2401)
XX
RN   [2]
RX   DOI; 10.1182/blood-2002-12-3944.
RX   PUBMED; 12816872.
RA   Nishikata I., Sasaki H., Iga M., Tateno Y., Imayoshi S., Asou N.,
RA   Nakamura T., Morishita K.;
RT   "A novel EVI1 gene family, MEL1, lacking a PR domain (MEL1S) is expressed
RT   mainly in t(1;3)(p36;q21)-positive AML and blocks G-CSF-induced myeloid
RT   differentiation";
RL   Blood 102(9):3323-3332(2003).
XX
DR   MD5; 93191976f060c744ac6139110ff8633a.
DR   Ensembl-Gn; ENSMUSG00000039410; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000030902; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000070313; mus_musculus.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..4330
FT                   /organism="Mus musculus"
FT                   /mol_type="mRNA"
FT                   /tissue_type="placenta"
FT                   /db_xref="taxon:10090"
FT   CDS             7..3834
FT                   /codon_start=1
FT                   /transl_table=1
FT                   /gene="mel1"
FT                   /product="transcription factor MEL1"
FT                   /db_xref="GOA:A2A935"
FT                   /db_xref="InterPro:IPR001214"
FT                   /db_xref="InterPro:IPR007087"
FT                   /db_xref="InterPro:IPR013087"
FT                   /db_xref="InterPro:IPR015880"
FT                   /db_xref="MGI:MGI:1917923"
FT                   /db_xref="UniProtKB/Swiss-Prot:A2A935"
FT                   /protein_id="BAC79382.1"
FT                   /translation="MRSKARAKKLAKSDGDVVNNMYEPDPDLLAGQSAEEETEDGILSP
FT                   IPMGPPSPFPTSEDFTPKEGSPYEAPVYIPEDIPIPPDFELRESSIPGAGLGIWAKRKM
FT                   EIGERFGPYVVTPRAALKEADFGWEMLTDTEVSSQESCIKKQISEDLGSEKFCVDANQA
FT                   GSGSWLKYIRVACSCDDQNLAMCQINEQIYYKVIKDIEPGEELLVHVKEGAYSLGVMAP
FT                   SLDEDPTFRCDECDELFQCRLDLRRHKKYACSSAGAQLYEGLGEELKPEGLGVGSDGQA
FT                   HECKDCERMFPNKYSLEQHMIVHTEEREYKCDQCPKAFNWKSNLIRHQMSHDSGKRFEC
FT                   ENCVKVFTDPSNLQRHIRSQHVGARAHACPDCGKTFATSSGLKQHKHIHSTVKPFICEV
FT                   CHKSYTQFSNLCRHKRMHADCRTQIKCKDCGQMFSTTSSLNKHRRFCEGKNHYTPGSIF
FT                   TPGLPLTPSPMMDKTKPSPTLNHGGLGFSEYFPSRPHPGSLPFSAAPPAFPTLTPGFPG
FT                   IFPPSLYPRPPLLPPTPLLKSPLNHAQDAKLPSPLGNPALPLVSAVSNSSQGATAATGS
FT                   EEKFDGRLEDAYAEKVKNRSPDMSDGSDFEDINTTTGTDLDTTTGTGSDLDSDLDSDRD
FT                   KGKDKGKPVESKPEFGGASVPPGAMNSVAEVPAFYSQHSFFPPPEEQLLTASGAAGDSI
FT                   KAIASIAEKYFDPGFMSMQEKKLGSLPYHSVFPFQFLLNFPHSLYPFTDRALAHNLLVK
FT                   AEPKSPQDALKVGGPSAECPFDLTTKPKEAKPALLAPKVPLIPSSGEEQPLDLSIGSRA
FT                   RASQNGGGREPRKNHVYGERKPGVSEGLPKVCPAQLPQQPSLHYAKPSPFFMDPIYRVE
FT                   KRKVADPVGVLKEKYLRPSPLLFHPQMSAIETMTEKLESFAAMKADSGSSLQPLPHHPF
FT                   NFRSPPPTLSDPILRKGKERYTCRYCGKIFPRSANLTRHLRTHTGEQPYRCKYCDRSFS
FT                   ISSNLQRHVRNIHNKEKPFKCHLCNRCFGQQTNLDRHLKKHEHEGAPVSQHSGVLTNHL
FT                   GTSASSPTSESDNHALLDEKEDSYFSEIRNFIANSEMNQASTRMDKRPEIQDLDSNPPC
FT                   PGSASAKPEDVEEEEEEELEEEDDDSLAGKSQEDTVSPTPEPQGVYEDEEDEEPPSLTM
FT                   GFDHTRRCVEERGGGLLALEPTPTFGKGLDLRRAAEEAFEVKDVLNSTLDSEVLKQTLY
FT                   RQAKNQAYAMMLSLSEDTPLHAPSQSSLDAWLNITGPSSESGAFNPINHL"
XX
SQ   Sequence 4330 BP; 1068 A; 1325 C; 1173 G; 764 T; 0 other;
     gaattcatgc gatccaaggc aagggcgaag aagctagcca aaagtgacgg tgacgttgta        60
     aataatatgt atgaacctga cccggacctg ctggccggcc agagtgccga ggaggagacc       120
     gaagacggca tcctgtcccc catccccatg gggccaccgt cccccttccc caccagcgag       180
     gacttcactc ccaaggaggg ctcgccctat gaggctcctg tctacattcc tgaagacatt       240
     ccaatcccac cagacttcga gctacgagag tcctccatac caggagctgg cctggggatc       300
     tgggccaagc ggaagatgga aatcggggag aggtttggcc cctacgtggt gacgccccgg       360
     gccgcactga aggaggccga ctttggatgg gagatgctga cggatacaga ggtgtcatcc       420
     caggagagct gcatcaaaaa gcagatctct gaagacttgg gtagcgagaa gttctgcgtg       480
     gatgccaatc aggcggggtc tggcagctgg ctcaagtaca tccgtgtagc gtgttcctgt       540
     gatgaccaaa acctcgccat gtgtcagatc aacgaacaga tttactataa agtcattaag       600
     gacatcgagc ctggagagga actgttggtg catgtgaaag aaggtgccta ctccttgggt       660
     gtcatggccc ccagcttgga tgaggacccc acattccgct gtgatgagtg tgatgagctc       720
     ttccagtgca ggctggacct gaggcgccac aagaagtacg cgtgcagctc tgcaggagcc       780
     cagctctacg agggcctagg ggaggaactc aagcccgagg gccttggcgt gggcagcgac       840
     gggcaagcgc atgagtgcaa ggattgcgag cggatgttcc ccaacaagta cagcttggag       900
     caacacatga tcgtccacac ggaagagcgt gagtacaaat gtgaccagtg tcccaaggcc       960
     ttcaactgga agtccaacct catccgccac cagatgtctc acgacagtgg caagcgcttc      1020
     gaatgtgaaa actgtgtcaa ggtgttcacg gaccccagca acctccagcg tcacatccgc      1080
     tcacagcatg tcggtgcccg ggcccatgcc tgccctgact gtggcaagac cttcgccaca      1140
     tcctctggcc tcaaacagca caagcatatc cacagcacgg tgaagccatt catatgcgag      1200
     gtctgccaca agtcctacac gcagttctcc aacctgtgcc ggcacaagcg gatgcacgcc      1260
     gactgcagga cgcagatcaa gtgcaaggac tgtgggcaga tgttcagcac tacctcctcc      1320
     ctcaacaagc atcggagatt ctgcgagggc aagaaccatt acacgcctgg cagcatcttc      1380
     accccaggcc tgcccttgac ccccagcccc atgatggaca agacaaaacc ctccccgacc      1440
     ctcaaccacg ggggcctagg cttcagcgag tacttcccct ccagacctca tcctgggagc      1500
     ctgcccttct cggctgctcc tccggccttc cccacactca ctccgggctt cccgggcatc      1560
     tttcctccat ccctgtaccc acgaccacct ctgctacctc ccacgccgct gctcaagagc      1620
     cccctgaacc acgcgcagga cgccaagcta cccagcccgc tgggaaaccc agccctgccc      1680
     cttgtctccg cggtcagcaa tagcagccag ggtgccacag cggccaccgg gtcagaggag      1740
     aaatttgatg gccgcttgga agacgcatat gcggagaagg tcaaaaatag gagccctgac      1800
     atgtcggacg gcagtgactt tgaggatatc aacaccacga ccgggacaga cttggacact      1860
     accacgggca cggggtcaga cctggacagc gacctggaca gtgacagaga caaaggcaag      1920
     gacaagggga agccagtgga gagcaaacct gagtttgggg gtgcatctgt gccccctggg      1980
     gccatgaaca gtgtggccga ggtaccggcc ttctactcac agcattcctt cttcccgcca      2040
     cccgaggaac agctgctgac ggcctcggga gctgccggcg actccatcaa ggccatcgcg      2100
     tccatcgcgg agaaatactt cgatcctggc ttcatgagca tgcaggagaa gaagctgggc      2160
     tcactaccct accactccgt gttccccttc cagttcctgc ttaactttcc ccactccctc      2220
     taccccttta cggaccgagc cctcgcccac aacttgctgg tcaaggctga gccaaagtca      2280
     ccccaggatg ccctcaaggt gggcggcccc agtgcggagt gccccttcga cctcaccacc      2340
     aaaccaaaag aggccaaacc cgccctgctc gcacccaagg tccccctcat cccctcatct      2400
     ggcgaggaac agccactgga cctgagcatc ggcagcaggg ccagggcaag ccagaacgga      2460
     ggtggccgtg agccgcggaa gaaccacgtc tacggtgaac ggaagccggg ggtcagcgag      2520
     gggctgccta aggtgtgccc agcacagctg ccccagcagc cctccttgca ttatgctaag      2580
     ccttcaccgt tcttcatgga tcccatctac agggtagaaa agcggaaggt ggcagaccct      2640
     gtgggagtcc tgaaagagaa gtacctgcgg ccgtccccac ttctgttcca cccccagatg      2700
     tcagccatag aaaccatgac ggagaagctg gagagctttg cagccatgaa ggccgactca      2760
     ggcagctccc tgcagcccct gcctcaccac ccgttcaact tccgctcccc acccccaacg      2820
     ctctcggatc ccatcctcag gaaggggaag gagagataca cgtgcaggta ctgtggcaag      2880
     atcttcccca gatctgcaaa tctcacaaga catctgagga cacacacagg ggagcagcca      2940
     tacaggtgca agtactgtga ccggtcattc agcatctcct ccaacctcca gcggcacgtg      3000
     aggaacatcc acaacaaaga gaagccgttc aagtgccatc tgtgcaaccg ctgcttcggg      3060
     cagcagacca acctagaccg gcacctgaag aagcacgaac acgagggcgc accagtgagc      3120
     cagcactccg gggtgctcac gaaccacctg ggcaccagcg cctcctcccc cacctccgag      3180
     tcggacaacc atgcactttt agatgagaag gaagattctt acttctccga gatccgaaac      3240
     ttcatcgcca acagcgagat gaaccaggca tccactcgaa tggacaaacg gcctgagatc      3300
     caagacctgg acagcaaccc accgtgtcca ggctcagcca gtgcaaagcc agaggacgta      3360
     gaggaggagg aagaggagga gctggaggaa gaggatgatg acagcttagc cgggaagtca      3420
     caggaggaca cggtgtcccc cacacctgag ccccaaggag tctatgaaga tgaagaggat      3480
     gaggaaccac ccagcctgac catgggcttt gaccataccc ggaggtgtgt tgaggagcga      3540
     ggaggcggcc tgttagcttt ggagccgacg ccgacctttg ggaaggggct ggatctccgc      3600
     agagcagctg aggaagcatt tgaagttaaa gatgtgctta attccacctt agattctgag      3660
     gttttaaaac aaaccctgta caggcaggct aagaaccagg catatgcaat gatgctgtcc      3720
     ctctctgaag acactcctct ccacgccccc tcccagagct cactggatgc ttggttgaac      3780
     atcacaggac cctcgtcaga gtccggagcc tttaacccca tcaaccacct ctgaggtcct      3840
     ggaggcccca gggccagagt ccaaagccag ggtaccagct gcaggagatg gagaaggggc      3900
     cagggagcag ccccccaccc tcaacacctc cactttgcaa agtccagctt ctccattgaa      3960
     actcagaacc cgaaggtccc tcgagtagcc gctggccttc atcacctctc tgaactggcc      4020
     tcaaggacac gatctgcagt gggtgcggtg cacgggccac ccaggagctg ctcacaggag      4080
     ccgtggatca gaaaactcgt gggcaagggt ggggtctcta tcccagcagg agccagttgg      4140
     ccacatccag gcaactgcat ggtatgaaag aggaaatcag aaagacgtgg gcaagtgcta      4200
     tggagagaga cctcatcaat gatttttata atgagaatca catgattaag ccttttggta      4260
     atcttattga ctatagagtc tatttaagca tgtgggtttt aaaaaaaata gacggtattt      4320
     tttaaaaatc                                                             4330
//


spacer
spacer