Dbfetch

ID   AB073864; SV 1; linear; mRNA; STD; HUM; 570 BP.
XX
AC   AB073864;
XX
DT   13-NOV-2001 (Rel. 69, Created)
DT   07-OCT-2008 (Rel. 97, Last updated, Version 3)
XX
DE   Homo sapiens mRNA for DJ-1, complete cds.
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-570
RA   Ariga H.;
RT   ;
RL   Submitted (02-NOV-2001) to the INSDC.
RL   Hiroyoshi Ariga, Graduate School of Pharmaceutical Sciences, Hokkaido
RL   University, Molecular Biology; Kita 12, Nishi 6, Kita-ku, Sapporo 060-0812,
RL   Japan (E-mail:hiro@pharm.hokudai.ac.jp, Tel:81-11-706-3745,
RL   Fax:81-11-706-4988)
XX
RN   [2]
RA   Ariga H., Niki T.;
RT   "human DJ-1 cDNA from PC3 cells";
RL   Unpublished.
XX
DR   MD5; 8d831e4e99ccc3b65b1f8c56fe83be1e.
DR   Ensembl-Gn; ENSG00000116288; homo_sapiens.
DR   Ensembl-Tr; ENST00000338639; homo_sapiens.
DR   Ensembl-Tr; ENST00000377488; homo_sapiens.
DR   Ensembl-Tr; ENST00000377491; homo_sapiens.
DR   Ensembl-Tr; ENST00000493373; homo_sapiens.
DR   Ensembl-Tr; ENST00000493678; homo_sapiens.
DR   EuropePMC; PMC521171; 15502868.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..570
FT                   /organism="Homo sapiens"
FT                   /mol_type="mRNA"
FT                   /cell_line="PC3"
FT                   /cell_type="prostate cancer"
FT                   /db_xref="taxon:9606"
FT   CDS             1..570
FT                   /codon_start=1
FT                   /transl_table=1
FT                   /gene="dj-1"
FT                   /product="DJ-1"
FT                   /note="a fertility-related and andorogen recepror-positive
FT                   regulator"
FT                   /db_xref="GOA:Q99497"
FT                   /db_xref="H-InvDB:HIT000061228.13"
FT                   /db_xref="HGNC:HGNC:16369"
FT                   /db_xref="InterPro:IPR002818"
FT                   /db_xref="InterPro:IPR006287"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="PDB:1J42"
FT                   /db_xref="PDB:1P5F"
FT                   /db_xref="PDB:1PDV"
FT                   /db_xref="PDB:1PDW"
FT                   /db_xref="PDB:1PE0"
FT                   /db_xref="PDB:1Q2U"
FT                   /db_xref="PDB:1SOA"
FT                   /db_xref="PDB:1UCF"
FT                   /db_xref="PDB:2OR3"
FT                   /db_xref="PDB:2R1T"
FT                   /db_xref="PDB:2R1U"
FT                   /db_xref="PDB:2R1V"
FT                   /db_xref="PDB:2RK3"
FT                   /db_xref="PDB:2RK4"
FT                   /db_xref="PDB:2RK6"
FT                   /db_xref="PDB:3B36"
FT                   /db_xref="PDB:3B38"
FT                   /db_xref="PDB:3B3A"
FT                   /db_xref="PDB:3BWE"
FT                   /db_xref="PDB:3CY6"
FT                   /db_xref="PDB:3CYF"
FT                   /db_xref="PDB:3CZ9"
FT                   /db_xref="PDB:3CZA"
FT                   /db_xref="PDB:3EZG"
FT                   /db_xref="PDB:3F71"
FT                   /db_xref="PDB:3SF8"
FT                   /db_xref="PDB:4BTE"
FT                   /db_xref="PDB:4MNT"
FT                   /db_xref="PDB:4MTC"
FT                   /db_xref="PDB:4N0M"
FT                   /db_xref="PDB:4N12"
FT                   /db_xref="PDB:4OGF"
FT                   /db_xref="PDB:4OQ4"
FT                   /db_xref="PDB:4P2G"
FT                   /db_xref="PDB:4P34"
FT                   /db_xref="PDB:4P35"
FT                   /db_xref="PDB:4P36"
FT                   /db_xref="PDB:4RKW"
FT                   /db_xref="PDB:4RKY"
FT                   /db_xref="PDB:4S0Z"
FT                   /db_xref="PDB:4ZGG"
FT                   /db_xref="PDB:5IP5"
FT                   /db_xref="PDB:5SY6"
FT                   /db_xref="PDB:5SY9"
FT                   /db_xref="PDB:5SYA"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q99497"
FT                   /protein_id="BAB71782.1"
FT                   /translation="MASKRALVILAKGAEEMETVIPVDVMRRAGIKVTVAGLAGKDPVQ
FT                   CSRDVVICPDASLEDAKKEGPYDVVVLPGGNLGAQNLSESAAVKEILKEQENRKGLIAA
FT                   ICAGPTALLAHEIGCGSKVTTHPLAKDKMMNGGHYTYSENRVEKDGLILTSRGPGTSFE
FT                   FALAIVEALNGKEVAAQVKAPLVLKD"
XX
SQ   Sequence 570 BP; 154 A; 117 C; 169 G; 130 T; 0 other;
     atggcttcca aaagagctct ggtcatcctg gctaaaggag cagaggaaat ggagacggtc        60
     atccctgtag atgtcatgag gcgagctggg attaaggtca ccgttgcagg cctggctgga       120
     aaagacccag tacagtgtag ccgtgatgtg gtcatttgtc ctgatgccag ccttgaagat       180
     gcaaaaaaag agggaccata tgatgtggtg gttctaccag gaggtaatct gggcgcacag       240
     aatttatctg agtctgctgc tgtgaaggag atactgaagg agcaggaaaa ccggaagggc       300
     ctgatagccg ccatctgtgc aggtcctact gctctgttgg ctcatgaaat aggctgtgga       360
     agtaaagtta caacacaccc tcttgctaaa gacaaaatga tgaatggagg tcattacacc       420
     tactctgaga atcgtgtgga aaaagacggc ctgattctta caagccgggg gcctgggacc       480
     agcttcgagt ttgcgcttgc aattgttgaa gccctgaatg gcaaggaggt ggcggctcaa       540
     gtgaaggctc cacttgttct taaagactag                                        570
//