spacer

EBI Dbfetch

ID   AB072269; SV 1; linear; mRNA; STD; MUS; 4065 BP.
XX
AC   AB072269;
XX
DT   27-MAR-2002 (Rel. 71, Created)
DT   02-FEB-2009 (Rel. 99, Last updated, Version 7)
XX
DE   Mus musculus mDSG2 mRNA for desmoglein 2, complete cds.
XX
KW   .
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi; Muroidea;
OC   Muridae; Murinae; Mus; Mus.
XX
RN   [1]
RP   1-4065
RA   Zhuxiang N., Hayashizaki Y., Garrod D.R.;
RT   ;
RL   Submitted (26-SEP-2001) to the INSDC.
RL   Contact:Nie Zhuxiang University of Manchester, Cellular, Immunological and
RL   Developmental Department; Oxford Road, Manchester M139PT, UK
XX
RN   [2]
RA   Zhuxiang N., Garrod D.R.;
RT   "Desmosomal cadherins mediate homophilic cell adhesion";
RL   Unpublished.
XX
RN   [3]
RC   Publication_Status: Available-Online
RX   DOI; 10.1101/gr.145100.
RX   PUBMED; 11042159.
RA   Carninci P., Shibata Y., Hayatsu N., Sugahara Y., Shibata K., Itoh M.,
RA   Konno H., Okazaki Y., Muramatsu M., Hayashizaki Y.;
RT   "Normalization and subtraction of cap-trapper-selected cDNAs to prepare
RT   full-length cDNA libraries for rapid discovery of new genes";
RL   Genome Res. 10(10):1617-1630(2000).
XX
DR   MD5; 68ed7c86ac733ec365333ed001a85a9a.
DR   Ensembl-Gn; ENSMUSG00000044393; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000059787; mus_musculus.
DR   EuropePMC; PMC2634090; 19262118.
DR   EuropePMC; PMC3023511; 21098030.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..4065
FT                   /organism="Mus musculus"
FT                   /mol_type="mRNA"
FT                   /country="United Kingdom"
FT                   /dev_stage="adult"
FT                   /clone_lib="RIKEN full-length enriched mouse cDNA library"
FT                   /clone="C820019D03"
FT                   /tissue_type="pancreas"
FT                   /db_xref="taxon:10090"
FT   CDS             198..3566
FT                   /codon_start=1
FT                   /transl_table=1
FT                   /gene="mDSG2"
FT                   /product="desmoglein 2"
FT                   /db_xref="GOA:O55111"
FT                   /db_xref="InterPro:IPR000233"
FT                   /db_xref="InterPro:IPR002126"
FT                   /db_xref="InterPro:IPR009122"
FT                   /db_xref="InterPro:IPR009123"
FT                   /db_xref="InterPro:IPR015919"
FT                   /db_xref="InterPro:IPR020894"
FT                   /db_xref="InterPro:IPR027397"
FT                   /db_xref="MGI:MGI:1196466"
FT                   /db_xref="UniProtKB/Swiss-Prot:O55111"
FT                   /protein_id="BAB86843.1"
FT                   /translation="MARSPGDRCALLLLVQLLAVVCLDFGNGLHLEVFSPRNEGKPFPK
FT                   HTHLVRQKRAWITAPVALREGEDLSRKNPIAKIHSDLAEEKGIKITYKYTGKGITEPPF
FT                   GIFVFDRNTGELNITSILDREETPYFLLTGYALDSRGNNLEKPLELRIKVLDINDNEPV
FT                   FTQEVFVGSIEELSAAHTLVMKITATDADDPETLNAKVSYRIVSQEPANSHMFYLNKDT
FT                   GEIYTTSFTLDREEHSSYSLTVEARDGNGQITDKPVQQAQVQIRILDVNDNIPVVENKM
FT                   YEGTVEENQVNVEVMRIKVTDAYEVGSDNWLANFTFASGNEGGYFHIETDTQTNEGIVT
FT                   LVKEVDYEEMKKLDLSIIVTNKAAFHKSILSKYKATPIPITVKVKNVVEGIHFKSSVVS
FT                   FRASEAMDRSSLSRSIGNFQVFDEDTGQAAKVTYVKVQDTDNWVSVDSVTSEIKLVKIP
FT                   DFESRYVQNGTYTAKVVAISKEHPQKTITGTIVITVEDVNDNCPVLVDSVRSVCEDEPY
FT                   VNVTAEDLDGAQNSAPFSFSIIDQPPGTAQKWKITHQESTSVLLQQSERKRGRSEIPFL
FT                   ISDSQGFSCPERQVLQLTVCECLKGGGCVAAQYDNYVGLGPAAIALMILALLLLLLVPL
FT                   LLLICHCGGGAKGFTPIPGTIEMLHPWNNEGAPPEDKVVPSLLVADHAESSAVRGGVGG
FT                   AMLKEGMMKGSSSASVTKGQHELSEVDGRWEEHRSLLTAGATHHVRTAGTIAANEAVRT
FT                   RATGSSRDMSGARGAVAVNEEFLRSYFTEKAASYNGEDDLHMAKDCLLVYSQEDTASLR
FT                   GSVGCCSFIEGELDDLFLDDLGLKFKTLAEVCLGRKIDLDVDIEQRQKPVTEASVSAAS
FT                   GSHYEQAVTSSESAYSSNTGFPAPKPLREVHTEKVTQEIVTESSVSSRQSQKVVPPPDP
FT                   VASGNIIVTETSYAKGSAVPPSTVLLAPRQPQSLIVTERVYAPTSTLVDQHYANEEKVL
FT                   VTERVIQPNGGIPKPLEVTQHLKDAQYVMVRERESILAPSSGVQPTLAMPSVAAGGQNV
FT                   TVTERILTPASTLQSSYQIPSETSITARNTVLSSVGSIGPLPNLDLEESDRPNSTITTS
FT                   STRVTKHSTMQHSYS"
FT   mat_peptide     198..3563
FT                   /gene="mDSG2"
FT                   /product="desmoglein 2"
FT                   /function="desmosomal adherin"
FT                   /experiment="experimental evidence, no additional details
FT                   recorded"
XX
SQ   Sequence 4065 BP; 1129 A; 1025 C; 1050 G; 861 T; 0 other;
     ttaattaaat taatcccccc cccccccgca tctaggctgt ggcccggccc aaggctaccc        60
     tttctgaccc gggcacacct ggaaccgcac cccgggtccc gcagagtcag agaagggcgg       120
     ccccgggagg gacctgccca ggaggatccg cagggcgccg gcgaggcccg gaggcgaggg       180
     cgcggcggat cgaggcgatg gcgcggagcc cgggtgaccg gtgcgccctg ctgctgctgg       240
     tgcagctgct ggcggtggtc tgcttggact ttggaaacgg acttcactta gaggtcttca       300
     gcccaagaaa tgaaggcaaa ccgttcccta agcacactca cttggttcgt caaaagaggg       360
     cctggatcac tgcccctgtg gctctgcggg agggcgaaga cctgtccaga aagaacccga       420
     ttgccaagat acactctgac cttgcagaag aaaaagggat aaaaatcacg tacaagtaca       480
     ctgggaaggg aattacagaa ccgcctttcg gcatattcgt ctttgataga aacacaggag       540
     aactgaacat cactagcatt cttgaccggg aagaaacacc atattttctg ctgacaggct       600
     atgcattgga ctccagagga aacaacctgg aaaagccctt ggaactacgc atcaaagttc       660
     tggacatcaa tgacaacgag ccagtgttca cacaggaggt ctttgttggg tccattgagg       720
     aattgagtgc agcacataca cttgtgatga aaatcaccgc cacagatgca gatgacccgg       780
     agactctgaa tgctaaagtc tcctacagaa ttgtctctca ggagcctgca aatagtcata       840
     tgttctacct aaataaagac acgggggaga tctatacgac cagttttact ttggacagag       900
     aggaacacag cagctattcc ttgacggtgg aagcaagaga tggtaacggg cagataacag       960
     acaagccagt ccagcaagct caagttcaga tccgtatatt ggatgtcaat gacaatatac      1020
     ctgtggtaga aaacaaaatg tatgagggga cagtggaaga aaaccaggtc aatgtagaag      1080
     tcatgcggat caaagtgacc gatgcatatg aagtgggctc tgataactgg ctagcaaact      1140
     ttacatttgc atcaggaaat gaagggggct atttccacat tgagactgac acacagacta      1200
     atgaagggat tgtgaccctt gtcaaggaag tggactatga agaaatgaag aagctagact      1260
     tgagcatcat tgtcactaac aaagcagctt tccacaagtc cattctgagc aagtacaagg      1320
     ccacgcccat tcccatcact gtcaaggtca agaacgtggt tgaaggcatt catttcaaga      1380
     gcagcgtagt ctctttccga gctagtgagg caatggatag atccagcctc agcaggtcga      1440
     ttggaaattt tcaagttttt gatgaagaca ctggtcaagc agctaaagta acatatgtaa      1500
     aagtgcaaga cactgacaac tgggtctctg tggactccgt cacttcagag attaagcttg      1560
     taaagattcc tgactttgaa tctagatatg tccaaaatgg tacctacact gcaaaggttg      1620
     tggccatatc caaagaacat cctcaaaaaa ccatcactgg caccatcgtt atcactgttg      1680
     aagacgtcaa tgacaattgt cccgtgctgg tggactctgt acggagtgtc tgtgaggatg      1740
     aaccatatgt gaatgtcact gcagaggatt tggatggggc ccagaacagt gcgccattca      1800
     gcttctccat cattgaccag cctcctggaa cggcacagaa gtggaaaata acgcaccagg      1860
     aaagtaccag tgtgctgctg cagcagagcg agcggaaacg cgggagaagt gagattccct      1920
     tcctcatttc cgacagccag ggcttcagct gccccgaaag gcaggtcctt cagctcactg      1980
     tatgcgagtg tctgaagggc ggtggctgtg tggctgcaca gtatgacaac tacgtcgggt      2040
     tgggccctgc cgccatcgct ctcatgattc tagcactcct gctcctgctc ctggtgccgc      2100
     tcttgctgtt gatatgccac tgtggagggg gcgccaaagg cttcaccccc attcctggga      2160
     caatagagat gctgcaccct tggaataatg aaggggcacc tcctgaggac aaggtggtgc      2220
     catcgcttct ggtggccgat catgcagaga gctcggcagt gagaggcggc gtaggaggtg      2280
     cgatgctcaa ggaaggcatg atgaaaggca gcagctcagc ttccgttacc aaagggcagc      2340
     atgagctgtc tgaggttgac ggaagatggg aagaacacag aagcctcctc accgctgggg      2400
     ccactcacca tgtaaggaca gcaggaacca tcgctgccaa cgaagccgta aggacaagag      2460
     ccacggggtc ttccagagac atgagtgggg ctcgaggagc cgttgccgtg aatgaggaat      2520
     tcttaagaag ttacttcaca gagaaagcgg cctcctacaa tggggaagac gaccttcaca      2580
     tggccaaaga ctgccttctc gtttactctc aggaagacac ggcctccctc cgaggctcgg      2640
     tcgggtgctg cagtttcatc gagggagaac tcgatgacct gttcctggat gatcttggcc      2700
     ttaaattcaa gaccctagct gaagtttgcc taggtcgaaa gatcgatctg gatgtggaca      2760
     ttgaacagag gcagaagccg gtcacagaag cgagcgtgag tgcagcttct ggctcgcact      2820
     atgagcaagc ggtaaccagc tcagagagcg cgtactcctc taacaccggc ttccccgccc      2880
     ccaaacctct gcgcgaagtg cacacagaga aagtcacaca ggaaatcgtc actgagagct      2940
     ctgtatcttc caggcagagt cagaaggtag taccgccacc tgatcctgtg gcttctggta      3000
     atattatagt gacggaaact tcctatgcca aaggctcagc agtgccaccc agcactgtgc      3060
     tcctggctcc cagacagcca cagagcctga tcgtgacaga gagggtgtat gctccaacct      3120
     ccaccttggt ggatcagcat tatgccaatg aagaaaaagt ccttgttacc gaacgagtga      3180
     tccagcctaa tgggggcatc cctaagcccc ttgaggtcac ccagcatctg aaagatgcac      3240
     agtatgtaat ggtgagggaa agagagagca tccttgctcc cagctcaggc gtgcagccca      3300
     ctctggcaat gcccagcgtg gcagcaggag gacagaatgt caccgtgaca gaaagaatac      3360
     taactcctgc ttccactctg cagtccagct accagattcc cagtgaaacc tccatcacgg      3420
     ctaggaacac tgtgctctct agtgtgggaa gcataggtcc tctgcccaat ttagatctag      3480
     aggaatctga tcgtcccaat tctactataa ccacatcttc caccagggtc accaagcata      3540
     gcaccatgca acattcttac tcctaaagag aagccagccg cagtcggatc tggaccttaa      3600
     ctagcatcca ctggatgtgt gtgtccatgc ccctaatgtt ataacagcca cacaagactt      3660
     gcacattgga aaaacttatt gacatgccaa acaaagacac catgtctcag gtagggttgt      3720
     atttcagcaa tgctctgtga ttattggggg atggagttaa gatgctagtt cctcagtgcc      3780
     ttttagagta ctgtgcaagc aatactcgca aacaggacat gtaaaattga gttccaagaa      3840
     cttacaaaac taaagcaggg tatctaattc atcaggtcca ggaggctggg tctctgcaca      3900
     atgcattgat attcagcagg gacagttcca ccccttatat tacagagcca cacaggttat      3960
     aggtaccaaa tagctcatcc acccagagac acatctccac tctttcatct ccactggaac      4020
     cctgagtaca ccagagggaa gaaaaaaaaa aaaaaaagag ctctt                      4065
//


spacer
spacer