spacer

EBI Dbfetch

ID   AB067525; SV 2; linear; mRNA; STD; HUM; 9768 BP.
XX
AC   AB067525;
XX
DT   17-SEP-2001 (Rel. 69, Created)
DT   07-OCT-2008 (Rel. 97, Last updated, Version 3)
XX
DE   Homo sapiens mRNA for KIAA1938 protein, partial cds.
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-9768
RA   Ohara O., Nagase T., Kikuno R.;
RT   ;
RL   Submitted (27-JUL-2001) to the INSDC.
RL   Osamu Ohara, Kazusa DNA Research Institute, Department of Human Gene
RL   Research; 1532-3, Yana, Kisarazu, Chiba 292-0812, Japan
RL   (E-mail:cdnainfo@kazusa.or.jp, URL:http://www.kazusa.or.jp/huge,
RL   Tel:81-438-52-3913, Fax:81-438-52-3914)
XX
RN   [2]
RX   DOI; 10.1093/dnares/8.4.179.
RX   PUBMED; 11572484.
RA   Nagase T., Kikuno R., Ohara O.;
RT   "Prediction of the coding sequences of unidentified human genes. XXI. The
RT   complete sequences of 60 new cDNA clones from brain which code for large
RT   proteins";
RL   DNA Res. 8(4):179-187(2001).
XX
DR   MD5; 668bfbab2662c711322cf3ccc4bc85f5.
DR   Ensembl-Gn; ENSG00000197283; homo_sapiens.
DR   Ensembl-Gn; ENSG00000227460; homo_sapiens.
DR   Ensembl-Tr; ENST00000293748; homo_sapiens.
DR   Ensembl-Tr; ENST00000395071; homo_sapiens.
DR   Ensembl-Tr; ENST00000414753; homo_sapiens.
DR   Ensembl-Tr; ENST00000418600; homo_sapiens.
DR   Ensembl-Tr; ENST00000428982; homo_sapiens.
DR   Ensembl-Tr; ENST00000455687; homo_sapiens.
DR   EuropePMC; PMC2925262; 19196676.
DR   H-InvDB; HIT000001653_03.4.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..9768
FT                   /organism="Homo sapiens"
FT                   /mol_type="mRNA"
FT                   /clone_lib="pBluescriptII SK plus"
FT                   /clone="hg00912s1"
FT                   /tissue_type="brain"
FT                   /db_xref="taxon:9606"
FT   CDS             <1..4133
FT                   /codon_start=3
FT                   /gene="KIAA1938"
FT                   /product="KIAA1938 protein"
FT                   /note="This sequence was obtained by subcloning of the DNA
FT                   fragments derived from two cDNA clones (1 - 3651 was
FT                   derived  from fg01207 and 3652 - 9768 was derived  from
FT                   hg00912)."
FT                   /db_xref="GOA:Q96PV0"
FT                   /db_xref="H-InvDB:HIT000001653_02.4"
FT                   /db_xref="HGNC:HGNC:11497"
FT                   /db_xref="InterPro:IPR000008"
FT                   /db_xref="InterPro:IPR001849"
FT                   /db_xref="InterPro:IPR001936"
FT                   /db_xref="InterPro:IPR008936"
FT                   /db_xref="InterPro:IPR011993"
FT                   /db_xref="InterPro:IPR021887"
FT                   /db_xref="InterPro:IPR023152"
FT                   /db_xref="InterPro:IPR023315"
FT                   /protein_id="BAB67831.2"
FT                   /translation="SSSSSTSSSFSPSFSPSFSLLSPPSPRPLPPGLMSRSRASIHRGS
FT                   IPAMSYAPFRDVRGPSMHRTQYVHSPYDRPGWNPRFCIISGNQLLMLDEDEIHPLLIRD
FT                   RRSESSRNKLLRRTVSVPVEGRPHGEHEYHLGRSRRKSVPGGKQYSMEGAPAAPFRPSQ
FT                   GFLSRRLKSSIKRTKSQPKLDRTSSFRQILPRFRSADHDRARLMQSFKESHSHESLLSP
FT                   SSAAEALELNLDEDSIIKPVHSSILGQEFCFEVTTSSGTKCFACRSAAERDKWIENLQR
FT                   AVKPNKDNSRRVDNVLKLWIIEARELPPKKRYYCELCLDDMLYARTTSKPRSASGDTVF
FT                   WGEHFEFNNLPAVRALRLHLYRDSDKKRKKDKAGYVGLVTVPVATLAGRHFTEQWYPVT
FT                   LPTGSGGSGGMGSGGGGGSGGGSGGKGKGGCPAVRLKARYQTMSILPMELYKEFAEYVT
FT                   NHYRMLCAVLEPALNVKGKEEVASALVHILQSTGKAKDFLSDMAMSEVDRFMEREHLIF
FT                   RENTLATKAIEEYMRLIGQKYLKDAIGEFIRALYESEENCEVDPIKCTASSLAEHQANL
FT                   RMCCELALCKVVNSHCVFPRELKEVFASWRLRCAERGREDIADRLISASLFLRFLCPAI
FT                   MSPSLFGLMQEYPDEQTSRTLTLIAKVIQNLANFSKFTSKEDFLGFMNEFLELEWGSMQ
FT                   QFLYEISNLDTLTNSSSFEGYIDLGRELSTLHALLWEVLPQLSKEALLKLGPLPRLLND
FT                   ISTALRNPNIQRQPSRQSERPRPQPVVLRGPSAEMQGYMMRDLNSSIDLQSFMARGLNS
FT                   SMDMARLPSPTKEKPPPPPPGGGKDLFYVSRPPLARSSPAYCTSSSDITEPEQKMLSVN
FT                   KSVSMLDLQGDGPGGRLNSSSVSNLAAVGDLLHSSQASLTAALGLRPAPAGRLSQGSGS
FT                   SITAAGMRLSQMGVTTDGVPAQQLRIPLSFQNPLFHMAADGPGPPGGHGGGGGHGPPSS
FT                   HHHHHHHHHHRGGEPPGDTFAPFHGYSKSEDLSSGVPKPPAASILHSHSYSDEFGPSGT
FT                   DFTRRQLSLQDNLQHMLSPPQITIGPQRPAPSGPGGGSGGGSGGGGGGQPPPLQRGKSQ
FT                   QLTVSAAQKPRPSSGNLLQSPEPSYGPARPRQQSLSKEGSIGGSGGSGGGGGGGLKPSI
FT                   TKQHSQTPSTLNPTMPASERTVAWVSNMPHLSADIESAHIEREEYKLKEYSKSMDESRL
FT                   DRVKEYEEEIHSLKERLHMSNRKLEEYERRLLSQEEQTSKILMQYQARLEQSEKRLRQQ
FT                   QAEKDSQIKSIIGRLMLVEEELRRDHPAMAEPLPEPKKRLLDAQERQLPPLGPTNPRVT
FT                   LAPPWNGLAPPAPPPPPRLQITENGEFRNTADH"
XX
SQ   Sequence 9768 BP; 2041 A; 2929 C; 2626 G; 2172 T; 0 other;
     cctcctcctc ctcctccacc tcctcctcct tctccccctc tttctccccc tctttctctc        60
     ttctttctcc cccgtccccc cgccccctcc ccccaggcct gatgagcagg tctcgagcct       120
     ccatccatcg ggggagcatc cccgcgatgt cctatgcccc cttcagagat gtacggggac       180
     cctctatgca ccgaacccaa tacgttcatt ccccgtatga tcgtcctggt tggaaccctc       240
     ggttctgcat catctcgggg aaccagctgc tcatgctgga tgaggatgag atacaccccc       300
     tactgatccg ggaccggagg agcgagtcca gtcgcaacaa actgctgaga cgcacagtct       360
     ccgtgccggt ggaggggcgg ccccacggcg agcatgaata ccacttgggt cgctcgagga       420
     ggaagagtgt cccagggggg aagcagtaca gcatggaggg tgcccctgct gcgcccttcc       480
     ggccctcgca aggcttcctg agccgacggc taaaaagctc catcaaacga acgaagtcac       540
     aacccaaact tgaccggacc agcagctttc gccagatcct gcctcgcttc cgaagtgctg       600
     accatgaccg ggcccggctg atgcaaagct ttaaggagtc acactctcat gagtccttgc       660
     tgagtcctag cagtgcagct gaggcattgg agctcaactt ggatgaagat tccattatca       720
     agccagtgca cagctccatc ctgggccagg agttctgttt tgaggtaaca acttcatcag       780
     gaacaaaatg ctttgcctgt cggtctgcgg ccgaaagaga caaatggatt gagaatctgc       840
     agcgggcagt aaagcccaac aaggacaaca gccgccgggt agacaatgtg ctaaagctgt       900
     ggatcataga ggcccgggag ctgcccccca agaagcggta ctactgtgag ctctgcctgg       960
     atgacatgct gtatgcacgc accacctcca agccccgctc tgcctctggg gacaccgtct      1020
     tctggggcga gcacttcgag tttaacaacc tgccggctgt ccgtgccctg cggctgcatc      1080
     tgtaccgtga ctcagacaaa aagcgcaaga aggacaaggc aggctatgtc ggcctggtga      1140
     ctgtgccagt ggccaccctg gctgggcgcc acttcacaga gcagtggtac cctgtaaccc      1200
     tgccaacagg cagtggggga tctgggggca tgggttcggg agggggaggg ggctcggggg      1260
     gtggctcagg gggcaagggc aaaggaggtt gcccggctgt gcggctgaaa gcacgttacc      1320
     agacaatgag catcttgccc atggagctat ataaagagtt tgcagagtat gtcaccaacc      1380
     attatcggat gctgtgtgca gtcttggagc ccgccctgaa tgtcaaaggc aaggaggagg      1440
     ttgccagtgc actagttcac atcctgcaga gtacaggcaa ggccaaggac ttcctttcag      1500
     acatggccat gtctgaggta gaccggttca tggaacggga gcacctcata ttccgcgaga      1560
     acacgcttgc cactaaagcc atagaagagt atatgagact gattggtcag aaatacctca      1620
     aggatgccat tggagaattc atccgtgctc tgtatgaatc tgaggaaaac tgcgaggtag      1680
     accctatcaa gtgcacagca tccagtttgg cagagcacca ggccaacctg cgaatgtgct      1740
     gtgagttggc cctgtgcaag gtggtcaact cccactgcgt gttcccgagg gagctgaagg      1800
     aggtgtttgc ttcgtggcgg ctgcgctgcg cagagcgagg ccgggaggac atcgcagaca      1860
     ggcttatcag cgcctcactc ttcctgcgct tcctctgccc agcgattatg tcgcccagtc      1920
     tctttgggct tatgcaggag tacccagatg aacagacctc acgaaccctc accctcattg      1980
     ccaaggtcat ccagaacctg gccaactttt ccaagtttac ctcaaaggag gactttctgg      2040
     gcttcatgaa tgagtttctg gagctggaat ggggttccat gcagcagttt ttgtatgaga      2100
     tctccaatct ggacacgcta accaacagca gtagctttga gggttacatc gacttgggcc      2160
     gagagctctc cacactgcat gccctactct gggaggtgct gccccagctc agcaaggaag      2220
     ccctcctgaa gctgggtcca ctgccccggc tcctcaacga catcagcaca gctctgagga      2280
     accccaacat ccaaaggcag ccaagccgcc agagtgagcg gccccggcct cagcctgtgg      2340
     tactgcgggg gccatcggct gagatgcagg gctacatgat gcgggacctc aacagctcca      2400
     tcgaccttca gtccttcatg gctcgaggcc tcaacagctc tatggacatg gctcgcctcc      2460
     cctccccaac caaggaaaag ccacccccac caccgcctgg tggtggtaaa gacctgttct      2520
     atgtaagccg tccacccctg gcccgttcct caccagcata ctgcacgagc agctcggaca      2580
     tcacagagcc agagcagaag atgctgagtg tcaacaagag tgtgtccatg ctggacttac      2640
     agggtgatgg gcctggtggc cgcctcaaca gcagcagtgt ttcgaacctg gcggccgtag      2700
     gggacctgct gcactcaagc caggcctcgc tgacagcagc cttggggcta cggcctgcgc      2760
     ctgccggacg cctctcccag gggagtggct catccatcac ggcggctggc atgcgcctca      2820
     gccagatggg tgtcaccaca gacggtgtcc ctgcccagca actgcgaatc cccctctcct      2880
     tccagaaccc tctcttccac atggctgctg atgggccagg tcccccaggc ggccatggag      2940
     ggggcggtgg ccatggccca ccttcctccc atcaccacca ccaccaccat caccaccacc      3000
     gaggtggaga gccccctggg gacacctttg ccccattcca tggctatagc aagagtgagg      3060
     acctctcttc cggggtcccc aagccccctg ctgcctccat ccttcatagc cacagctaca      3120
     gtgatgagtt tggaccctct ggcactgact tcacccgtcg gcagctttca ctccaggaca      3180
     acctgcagca catgctgtcc cctccccaga tcaccattgg tccccagagg ccagccccct      3240
     cagggcctgg aggtgggagc ggtgggggca gcggtggggg tggcgggggc cagccgcctc      3300
     cattgcagag gggcaagtct cagcagttga cagtcagcgc agcccagaaa ccccggccat      3360
     ccagcgggaa tctattgcag tccccagagc caagttatgg ccccgcccgt ccacggcaac      3420
     agagcctcag caaggagggc agcattgggg gcagcggggg cagcggtggc ggagggggtg      3480
     gggggctgaa gccctccatc accaagcagc attctcagac accatccaca ttgaacccca      3540
     caatgccagc ctctgagcgg acagtggcct gggtctccaa catgcctcac ctgtcggctg      3600
     acatcgagag tgcccacatc gagcgggaag agtacaagct caaggagtac tcaaaatcga      3660
     tggatgagag ccggctggat agggtgaagg agtacgagga ggagattcac tcactgaaag      3720
     agcggctgca catgtccaac cggaagctgg aagagtatga gcggaggctg ctgtcccagg      3780
     aagaacaaac cagcaaaatc ctgatgcagt atcaggcccg actggagcag agtgagaaga      3840
     ggctaaggca gcagcaggca gagaaggatt cccagatcaa gagcatcatt ggcaggctga      3900
     tgctggtgga ggaggagctg cgccgggacc accccgccat ggctgagccg ctgccagaac      3960
     ccaagaagag gctgctcgac gctcaggaga ggcagcttcc ccccttgggt ccaacaaacc      4020
     cgcgtgtgac gctggcccca ccgtggaatg gcctggcccc cccagcccca ccacccccac      4080
     cccggctgca gattacggag aacggcgagt tccgaaacac cgcagaccac tagcccaccc      4140
     agcatcagag accttctctt cctttcctgt gcaccccacc ctgtaacagc accaaccacc      4200
     aggattggac atcaccgagg aacagcggga ttgcctcccc gaatgcctcc ctgggaggca      4260
     cactgattgc ccacccccac cactgcacca tttccaggag ggagagtggg gaccctcagc      4320
     cgcccccttt tccttcccat tggggtgctg ccctctcttt gacccccagg gacccttgcc      4380
     ccaggacacc gcctaccccg tacagacccc ttcactccgg ggtgctatcc ccatcctctg      4440
     cctcatcgtt cccctgagca ctgggggaca gaccctcacc cccaccctgg gggtgtggca      4500
     cctccaaact ttcaacttca gggtgatttt tttagcagta accagagctg acaatctaac      4560
     tcccctccac cgccccattt tggcctcccc tgcccccctt gttatgggga ggggaccccg      4620
     ggtgaggggg ccctattacc ccttgatttc tcaggagcgt ctgggggggc tcagcacgca      4680
     caaactcctt ctccttctac cactcttaaa tttactccct ccccacccag aacccagatg      4740
     gggtggaggg ggccaccggg gcagggaggg ggcggcaagg ggggaatggg agttgtctcc      4800
     ccttctcccc acacctgatc tgctctcggc tggtcccaga gcggggtgag ggggcttatg      4860
     cccccccctc ccccagtgtg ttgggtgggg tggaattgag gttagggtga ggggtcaggg      4920
     tttaggaggg tgtgtatgtt gggaggacag gctagttgat ctgtcctact ctgacacaca      4980
     gtcccctctg ccccttcctt ctctcttctt ggtctctact cccaggggga ggggggaact      5040
     tactctagga aaagccatgt ctctctcccc cagggtgggg ggacctgtgt tggaggaggg      5100
     gtgttggggg gcccccttcc atgactctgt cccctggggg aggtaggaca gggctgggct      5160
     tccctctcat cctccccctc ccaatctcct tccacctccc tccctcccgc cagctccacg      5220
     atttttcggt gtttctctgt acatagtttt ctggcgggat aggggaggta ggatggatgg      5280
     ggtttggggt gggtaggcca tgggagggga gaagcccctc cttggcaccc cctcttccct      5340
     gactgctgtc ccctacccag ccttgccccc ttcatccttt tgcgtttggt attgagactc      5400
     tcctagactc tactcctctt tcttttgtat ggacagttcc ccttcagtcc catcccccta      5460
     cacatacacc cagccggggc caaatttata cttatataaa agttgtaaat atgtgaaatt      5520
     ttatccctgt gccctttccc cacctcaggc cctacccctg gaccctcccc aaccttcctt      5580
     ctctcttctt tggctgttgt aattatctgg ggtttgtact gtacatatcc ggggtgtgtg      5640
     tgtgtgggct gggggcaacc cttctgtaca gagcttcctg gccccctccc cccccgcccc      5700
     tctgcttccc tccccaccca ccacctcaag ggtagggagt tgctcttcct acctgtttta      5760
     ttttgttttc tcgttctccc tccccacccc actcccagcc ttatctatcc cccctcactg      5820
     tccccttttc tccactccca gccccatttc ctttttttct ggagtgtgtg gtgaaacaga      5880
     aaaaaacatg tttaataaac ggagattgtt cttttatcgc tgtgccgact ttcttaggca      5940
     gggctctcca gacctgtacg gtggtaagat ctgctttctg aaaggaagct gacagcctga      6000
     gaggaaaacc gtatatcccc acctgatgcc acactctcct catagaatgt cactctcccc      6060
     tcccaatgag attttttata ttttagagca ggagttttgc accggccaaa cttctccaat      6120
     ctaactctcc cctcaccact gtgtcactta gtccgaggcc aggaacagcg gcgttatctg      6180
     ataaaagagt tcatgtatat atccacattt atctctttta aaaattacct agaaataagg      6240
     tttctttaat tgctggttaa aatgctcccg tgcagaaaac aggaaagaac ctgcctggtt      6300
     ccttagcaaa tctgagttcc agtcccaggt ccactactat tagctgagtg acgcttccag      6360
     cccgtttccc ccgcctggaa actgaggacg gcaaccccca ccctcgcagg gccggtggga      6420
     agacacaaag tgatgtgggc aagtgccagg cccacatggt aagtacccaa ctaatctcgc      6480
     ccctctcagg acctaccggg ggcgggtgct acacttaatc accgggaaac gcagctttcc      6540
     ggggcggctg acggcccacc ccctccgacc gggctgttct ctcccgggcc ctgcctctcg      6600
     gtcctctgca gcggggagga cttcagcagc tccccgggac gcccgttgcg aggacaccct      6660
     gggcctgtgc cctcctacta gcaccgccct cctcgtctgc agtagccaat caacacgagg      6720
     cttgtaggct gccgttcctc gattggctac ggctctagct ccgcccgccg cacttggcga      6780
     cggtgtccgg cggggaggcg gcggcttccg gtctgggacg gagctgtagc ggcactgtaa      6840
     ctgcgagggc agcgccgcgt gtgtaacggc gggggcgtgt cggcgggaag gacaatcggg      6900
     ccgggactcg cggtgtccgg gtgaccgcgg cttcccggga gcagacctct gtgggcactg      6960
     tgaggcggaa cggagcggcg gggcaggagc tgttgtgggc aggtgaaggc aggctggtgg      7020
     ctgaaggacc tccttcttat cttccacagg ggctggaagt taaaacccct gttggtgttt      7080
     agtggtggtg gttgttgttg ttgtttgttt ttgctttctt ggtgtgcggg actgatttgc      7140
     agaaaccgcc actgacttaa aagtttccag ttattgctcg tggggagggg gttgtttgag      7200
     aagatgtggc tccctttatc cagggcttct gtgacctcca tctttttcct ctgcagcctt      7260
     catcccgcgt ggagtctacc cccaagccct tctcctcttc ccaattcttg tcaccttcga      7320
     ggaggccatg gaaaccccaa cacctttgcc gcctgtaccc gcctccccga cctgcaaccc      7380
     agccccacgg acaatccaga tcgagttccc acagcatagc tcgtcgctgc tggaatctct      7440
     gaaccgccac aggctagagg gaaagttctg tgatgtgtcc ctcctggtgc agggccggga      7500
     acttagggct cataaagcag tgttagctgc tgcctctcct tacttccatg acaagctgct      7560
     tctgggggat gcgcctcgtc tcactctacc gagtgtcatt gaagccgatg ccttcgaggg      7620
     gctgctccag ctcatttatt cagggcgtct ccgcctgcca ctggatgctc ttcctgctca      7680
     tctccttgtg gccagtggcc ttcaaatgtg gcaggtagta gatcagtgct cagaaattct      7740
     tagagaatta gaaacttcag gtggtggaat ttcagcccgt ggaggaaact cctaccatgc      7800
     ccttctttcc actacatcct ctacaggagg ctggtgcatt cgctcttcgc ctttccagac      7860
     cccagtacag tcctctgctt ctactgaaag ccctgcttcc actgagagcc ctgtgggagg      7920
     ggagggaagt gaactgggag aagtgctgca aattcaggtg gaagaagaag aggaggagga      7980
     ggaagatgat gatgatgagg accaggggtc agccacactc tctcagactc ctcagcccca      8040
     gagagtatca ggggtttttc cccgtcctca tggaccccac ccactgccca tgactgctac      8100
     tccccgaaag cttccagagg gtgagagtgc accacttgag cttcctgccc ctcctgcact      8160
     gccccccaaa atcttctaca ttaagcagga acccttcgag cctaaggagg agatatcagg      8220
     aagcggaact cagcctggag gagcaaagga ggaaaccaaa gtgttttctg gaggggacac      8280
     tgaagggaat ggggagctag ggttcttgtt gccttcaggg ccagggccaa catctggggg      8340
     agggggtcca tcctggaaac cagtggatct tcatgggaat gaaatcctgt cagggggtgg      8400
     aggacctggg ggagcaggcc aggccgtgca tgggcctgtg aagctagggg ggacaccccc      8460
     tgcagatgga aaacgctttg gttgcctgtg tgggaagcgg tttgcagtga agccaaagcg      8520
     tgaccggcac atcatgctga ccttcagcct tcggcctttt ggctgtggca tctgcaacaa      8580
     gcgcttcaag ctgaagcacc atctgacaga gcacatgaag acccatgctg gagccctgca      8640
     tgcctgtccc cactgtggcc gtcggttccg agtccatgcc tgttttctcc gccaccggga      8700
     cctatgcaag ggccagggct gggccactgc ccactggact tacaagtgac tgctgaggct      8760
     atacactagc ttctagaaca agataaccac tgctgctgat ggatactttt ccctcactgc      8820
     catggcacac cagtcatgga tcttgtaatc atgccaagag aatagataca ttatggacct      8880
     cttgttctta gatatgggcc tctcagcctg gcagatgtgg aaactcaaat ttctcgtccc      8940
     actccaggtt ttggctagcc aaccctgcag gaaagtggtt tataggccat tcatacttaa      9000
     gttgatcact tgcccatggt ggacattttt gtggtggtga tgtccattaa ggaaaccaga      9060
     ttttcaatta tttagtgaga gaagagttag agcaaaagac agtggtaaat gttttattcc      9120
     gtctccatga ggaattgaag gagttggtct ccacctagag atacatttga tttacagctt      9180
     aagtaattca gaggctaagc tctaagcttt tttctctcat tgctggaatg atttaagcag      9240
     aagtcctttt gtgtactttt aaaattgtat ctttccagga gcccctcaga ttgtaccttg      9300
     ctttctcacc aatagacacc ttcccgacac ttttttaatg ttgtagctga gcactttaac      9360
     aagttgagca ttccatgttt cattcttaga accttcttta atagagggtc ttccctcaac      9420
     agcctgtgcc tctggtctac ctttgaccac cactgataac taatatattg gtcacaatga      9480
     ctggaatgtg actagtgatc tcaggagatg gcactgtcct aaagtgctgt cagggtggca      9540
     ccactgctct ctgaacaact taccttggtc agagggactc aggtttggga cagcacaagc      9600
     tgaaggctgg agagtaactt gcatagtagg accatacctc ttcctttccc atcccaccca      9660
     catatgatag acagcccctc tgttgagata tggaggggac agatactgga atcgggggtg      9720
     ggacttgcag ttacttaaaa ttttttaata aactgtgccc tgaaacct                   9768
//


spacer
spacer