spacer

EBI Dbfetch

ID   AB062112; SV 2; linear; mRNA; STD; HUM; 858 BP.
XX
AC   AB062112;
XX
DT   04-FEB-2002 (Rel. 70, Created)
DT   07-OCT-2008 (Rel. 97, Last updated, Version 5)
XX
DE   Homo sapiens HLA-DRB1*1405 mRNA for MHC class II antigen, complete cds.
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-858
RA   Kohsaka H., Matsushita S.;
RT   ;
RL   Submitted (22-MAY-2001) to the INSDC.
RL   Hitoshi Kohsaka, Tokyo Medical and Dental University, Department of
RL   Bioregulatory Medicine and Rheumatology; 1-5-45 Yushima, Bunkyo-ku, Tokyo
RL   113-8519, Japan (E-mail:kohsaka.rheu@tmd.ac.jp, URL:www.tmd.ac.jp,
RL   Tel:81-3-5803-5204, Fax:81-3-5803-5998)
XX
RN   [2]
RX   DOI; 10.1080/1042517021000041822.
RX   PUBMED; 12652907.
RA   Kohsaka H., Nasu K., Matsushita S., Miyasaka N.;
RT   "Complete cDNA coding sequence of the HLA-DRB1*1405 allele";
RL   DNA Seq 13(6):359-361(2002).
XX
DR   MD5; 7e3b5f580281c4583aa3db73081d8e8a.
DR   Ensembl-Gn; ENSG00000196126; homo_sapiens.
DR   Ensembl-Gn; ENSG00000206240; homo_sapiens.
DR   Ensembl-Gn; ENSG00000206306; homo_sapiens.
DR   Ensembl-Gn; ENSG00000228080; homo_sapiens.
DR   Ensembl-Tr; ENST00000328980; homo_sapiens.
DR   Ensembl-Tr; ENST00000360004; homo_sapiens.
DR   Ensembl-Tr; ENST00000399450; homo_sapiens.
DR   Ensembl-Tr; ENST00000412634; homo_sapiens.
DR   Ensembl-Tr; ENST00000415796; homo_sapiens.
DR   Ensembl-Tr; ENST00000419393; homo_sapiens.
DR   Ensembl-Tr; ENST00000428566; homo_sapiens.
DR   H-InvDB; HIT000059868_05.4.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..858
FT                   /organism="Homo sapiens"
FT                   /mol_type="mRNA"
FT                   /cell_line="EBSM"
FT                   /cell_type="B lymphocyte"
FT                   /db_xref="taxon:9606"
FT   CDS             45..845
FT                   /codon_start=1
FT                   /transl_table=1
FT                   /gene="HLA-DRB1"
FT                   /allele="HLA-DRB1*1405"
FT                   /product="MHC class II antigen"
FT                   /note="HLA-DR14"
FT                   /db_xref="GOA:Q9GIY3"
FT                   /db_xref="H-InvDB:HIT000059868_04.4"
FT                   /db_xref="HGNC:HGNC:4948"
FT                   /db_xref="IMGT/HLA:DRB1*14:05:01"
FT                   /db_xref="InterPro:IPR000353"
FT                   /db_xref="InterPro:IPR003006"
FT                   /db_xref="InterPro:IPR003597"
FT                   /db_xref="InterPro:IPR007110"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR014745"
FT                   /protein_id="BAB84521.2"
FT                   /translation="MVCLRLPGGSCMAVLTVTLMVLSSPLALAGDTRPRFLEYSTSECQ
FT                   FFNGTERVRFLDRYFHNQEEFVRFDSDVGEYRAVTELGRPDAEYWNSQKDLLERRRAEV
FT                   DTYCRHNYGVVESFTVQRRVHPKVTVYPSKTQPLQHHNLLVCSVSGFYPGSIEVRWFRN
FT                   GQEEKTGVVSTGLIHNGDWTFQTLVMLETVPRSGEVYTCQVEHPSVTSPLTVEWRARSE
FT                   SAQSKMLSGVGGFVLGLLFLGAGLFIYFRNQKGHSGLQPRGFLS"
XX
SQ   Sequence 858 BP; 177 A; 219 C; 275 G; 187 T; 0 other;
     acttgcctgc tgctctggcc cctggtcctg tcctgttctc cagcatggtg tgtctgaggc        60
     tccctggagg ctcctgcatg gcagttctga cagtgacact gatggtgctg agctccccac       120
     tggctttggc tggggacacc agaccacgtt tcttggagta ctctacgtct gagtgtcaat       180
     tcttcaatgg gacggagcgg gtgcggttcc tggacagata cttccataac caggaggagt       240
     tcgtgcgctt cgacagcgac gtgggggagt accgggcggt gacggagctg gggcggcctg       300
     atgctgagta ctggaacagc cagaaggacc tcctggagcg gaggcgggcc gaggtggaca       360
     cctattgcag acacaactac ggggttgtgg agagcttcac agtgcagcgg cgagtccatc       420
     ctaaggtgac tgtgtatcct tcaaagaccc agcccctgca gcaccacaac ctgctggtct       480
     gttctgtgag tggtttctat ccaggcagca ttgaagtcag gtggttccgg aatggccagg       540
     aagagaagac tggggtggtg tccacaggcc tgatccacaa tggagactgg accttccaga       600
     ccctggtgat gctggaaaca gttcctcgga gtggagaggt ttacacctgc caagtggagc       660
     acccaagcgt gacaagccct ctcacagtgg aatggagagc acggtctgaa tctgcacaga       720
     gcaagatgct gagtggagtc gggggctttg tgctgggcct gctcttcctt ggggccgggc       780
     tgttcatcta cttcaggaat cagaaaggac actctggact tcagccaaga ggattcctga       840
     gctgaagtgc agatgaca                                                     858
//


spacer
spacer