spacer

EBI Dbfetch

ID   AB057731; SV 1; linear; mRNA; STD; MUS; 1243 BP.
XX
AC   AB057731;
XX
DT   11-JUL-2001 (Rel. 68, Created)
DT   23-SEP-2008 (Rel. 97, Last updated, Version 2)
XX
DE   Mus musculus mLIP1 mRNA for lipoic acid synthase, complete cds.
XX
KW   .
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi; Muroidea;
OC   Muridae; Murinae; Mus; Mus.
XX
RN   [1]
RP   1-1243
RA   Wada H.;
RT   ;
RL   Submitted (19-MAR-2001) to the INSDC.
RL   Hajime Wada, Kyushu University, Department of Biology, Faculty of Sciences;
RL   4-2-1 Ropponmatsu, Fukuoka, Fukuoka 810-8560, Japan
RL   (E-mail:wadarcb@mbox.nc.kyushu-u.ac.jp, Tel:81-92-726-4761,
RL   Fax:81-92-726-4761)
XX
RN   [2]
RX   DOI; 10.1016/S0014-5793(01)02469-3.
RX   PUBMED; 11389890.
RA   Morikawa T., Yasuno R., Wada H.;
RT   "Do mammalian cells synthesize lipoic acid? Identification of a mouse cDNA
RT   encoding a lipoic acid synthase located in mitochondria";
RL   FEBS Lett. 498(1):16-21(2001).
XX
DR   MD5; a4465457835923ae391d3686fce7b05f.
DR   Ensembl-Gn; ENSMUSG00000029199; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000031101; mus_musculus.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1243
FT                   /organism="Mus musculus"
FT                   /mol_type="mRNA"
FT                   /db_xref="taxon:10090"
FT   CDS             32..1153
FT                   /codon_start=1
FT                   /gene="mLIP1"
FT                   /product="lipoic acid synthase"
FT                   /db_xref="GOA:Q99M04"
FT                   /db_xref="InterPro:IPR003698"
FT                   /db_xref="InterPro:IPR006638"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="MGI:MGI:1934604"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q99M04"
FT                   /protein_id="BAB62009.1"
FT                   /translation="MALRCWDTARSLGSRIFGRYAFTVRALSSLPDKKKEFLHNGPDLQ
FT                   DFVSGDLADKSTWDEYKGNLKRQKGERLRLPPWLKTKIPMGKNYNKLKNTLRNLSLHTV
FT                   CEEARCPNIGECWGGGEYATATATIMLMGDTCTRGCRFCSVKTARNPPPLDANEPDNTA
FT                   KAIAEWGLDYVVLTSVDRDDVADGGAEHIAKTVSCLKERNPKILVECLTPDFRGDLRAV
FT                   EKVALSGLDVYAHNVETVPELQRKVRDPRANFDQSLRVLRHAKEVQPDVVSKTSIMLGL
FT                   GETDEQVYATLKALRAADVDCLTLGQYMQPTKRHLKVEEYVTPEKFKYWEKVGNELGFL
FT                   YTASGPLVRSSYKAGEFFLKNLVARRKTKASKV"
XX
SQ   Sequence 1243 BP; 356 A; 259 C; 337 G; 291 T; 0 other;
     ccttgacact cctgagacct aaaagagggg gatggctcta cgctgctggg atacagctcg        60
     cagcctgggg tcccggatat ttggaagata tgcgttcacg gttagagcat taagttcttt       120
     gccagataag aaaaaggaat ttttgcataa tggaccagac cttcaagatt ttgtatctgg       180
     tgatcttgca gacaagagta catgggatga atataaagga aacttaaagc gccagaaagg       240
     agaaaggcta agactacctc catggctaaa gacaaagata cccatgggta aaaactacaa       300
     taaactgaaa aatacattgc ggaatttaag tctccacaca gtgtgtgagg aagcccggtg       360
     ccccaacatt ggagagtgtt ggggaggtgg ggaatatgcc acagccacag ccacgatcat       420
     gttgatgggg gacacatgca caagaggttg cagattttgt tccgttaaga ccgcaagaaa       480
     tccccctcca ttggatgcca atgagcccga caatacggcc aaagcaattg cagagtgggg       540
     tctggattat gttgtcctga cgtcggtgga tcgagatgat gtggccgacg ggggagctga       600
     gcacatcgcc aagaccgtgt catgcttgaa ggaaaggaat ccaaaaatcc tcgtggaatg       660
     cctcacccca gacttccgag gtgatctgag agcagtggag aaggtggctc tgtctggatt       720
     agatgtgtat gcacacaatg tggagactgt ccccgagtta cagaggaaag ttcgtgatcc       780
     ccgggccaat tttgaccagt ctcttcgtgt actgagacat gccaaggagg tccagcctga       840
     tgttgtttcc aaaacatcga taatgctggg ccttggtgag acagacgagc aagtctatgc       900
     cacactgaaa gctctccgtg cggccgacgt ggactgttta actctagggc agtacatgca       960
     gccaacgaag cgccacctta aggttgaaga atatgttact cctgagaagt tcaaatactg      1020
     ggaaaaagta gggaatgaac ttggatttct ctatacggca agtggtcctt tggtgcgatc      1080
     ttcatataaa gcaggtgaat ttttcctgaa aaatctagtg gctagaagaa aaacaaaagc      1140
     ttctaaagtg tagccaagcc cttcaagatc acaggagtgt tgcgattttg cttccagttg      1200
     gtgtgaggat ggtgtcaccc tgtcaggatt cctgtgagtg caa                        1243
//


spacer
spacer