Dbfetch

ID   AB051457; SV 1; linear; mRNA; STD; HUM; 4906 BP.
XX
AC   AB051457;
XX
DT   06-MAR-2001 (Rel. 67, Created)
DT   07-OCT-2008 (Rel. 97, Last updated, Version 5)
XX
DE   Homo sapiens mRNA for KIAA1670 protein, partial cds.
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-4906
RA   Ohara O., Nagase T., Kikuno R.;
RT   ;
RL   Submitted (22-NOV-2000) to the INSDC.
RL   Osamu Ohara, Kazusa DNA Research Institute, Department of Human Gene
RL   Research; 1532-3, Yana, Kisarazu, Chiba 292-0812, Japan
RL   (E-mail:cdnainfo@kazusa.or.jp, URL:http://www.kazusa.or.jp/huge,
RL   Tel:81-438-52-3913, Fax:81-438-52-3914)
XX
RN   [2]
RX   DOI; 10.1093/dnares/8.1.1.
RX   PUBMED; 11258795.
RA   Hirosawa M., Nagase T., Murahashi Y., Kikuno R., Ohara O.;
RT   "Identification of novel transcribed sequences on human chromosome 22 by
RT   expressed sequence tag mapping";
RL   DNA Res. 8(1):1-9(2001).
XX
DR   MD5; 438a1649defcafc44aea64c2bac73a30.
DR   Ensembl-Gn; ENSG00000205560; homo_sapiens.
DR   Ensembl-Tr; ENST00000312108; homo_sapiens.
DR   Ensembl-Tr; ENST00000360719; homo_sapiens.
DR   Ensembl-Tr; ENST00000395650; homo_sapiens.
DR   Ensembl-Tr; ENST00000405237; homo_sapiens.
DR   Ensembl-Tr; ENST00000457250; homo_sapiens.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..4906
FT                   /organism="Homo sapiens"
FT                   /mol_type="mRNA"
FT                   /clone="hh04251"
FT                   /note="vector:pBluescriptII SK plus"
FT                   /db_xref="taxon:9606"
FT   CDS             <2158..3954
FT                   /codon_start=1
FT                   /gene="KIAA1670"
FT                   /product="KIAA1670 protein"
FT                   /note="Start codon is not identified."
FT                   /db_xref="GOA:Q92523"
FT                   /db_xref="H-InvDB:HIT000001386.16"
FT                   /db_xref="HGNC:HGNC:2329"
FT                   /db_xref="InterPro:IPR000542"
FT                   /db_xref="InterPro:IPR032476"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q92523"
FT                   /protein_id="BAB33340.1"
FT                   /translation="GSGDRPVPEFECRPTPRMAEAHQAVAFQFTVTPDGVDFRLSREAL
FT                   KHVYLSGINSWKKRLIRIKNGILRGVYPGSPTSWLVVIMATVGSSFCNVDISLGLVSCI
FT                   QRCLPQGCGPYQTPQTRALLSMAIFSTGVWVTGIFFFRQTLKLLLCYHGWMFEMHGKTS
FT                   NLTRIWAMCIRLLSSRHPMLYSFQTSLPKLPVPRVSATIQRYLESVRPLLDDEEYYRME
FT                   LLAKEFQDKTAPRLQKYLVLKSWWASNYVSDWWEEYIYLRGRSPLMVNSNYYVMDLVLI
FT                   KNTDVQAARLGNIIHAMIMYRRKLDREEIKPVMALGIVPMCSYQMERMFNTTRIPGKDT
FT                   DVLQHLSDSRHVAVYHKGRFFKLWLYEGARLLKPQDLEMQFQRILDDPSPPQPGEEKLA
FT                   ALTAGGRVEWAQARQAFFSSGKNKAALEAIERAAFFVALDEESYSYDPEDEASLSLYGK
FT                   ALLHGNCYNRWFDKSFTLISFKNGQLGLNAEHAWADAPIIGHLWEFVLGTDSFHLGYTE
FT                   TGHCLGKPNPALAPPTRLQWDIPKQCQAVIKSSYQVAKALADDVELYCFQFLPFGKGLI
FT                   KKCRTSPDAFVQIALQLAHFRG"
XX
SQ   Sequence 4906 BP; 1027 A; 1432 C; 1459 G; 988 T; 0 other;
     cccgggccgg ggcacggaga gagccgagcg ccgcagccgt gagccgaata gagccggaga        60
     gacccgagta tgaccggaga agcccaggcc ggccggaaga ggagccgagc gcggccggaa       120
     ggaaccgagc ccgtccgaag ggagcggagc gcagcctggc ctggggcccg gtcgagcccg       180
     cgccatggcg gccgaggcga cagctgtggc cggaagcggg gctgttggcg gctgcctggc       240
     caaagacggc ttgcagcagt ctaagtgccc ggacactacc ccaaaacggc ggcgcgcctc       300
     gtcgctgtcg cgtgacgccg agcgccgagc ctaccaatgg tgccgggagt acttgggcgg       360
     ggcctggcgc cgagtgcagc ccgaggagct gagggtttac cccgtgaggt gggaggtcag       420
     gggtcagcct ctccggtgcg cggatcgggg tcaggggtca gccgcggggc cctcaggatg       480
     ctccatgttt tcgcccccct cttgcgcccg cgcctggggc ggggcggggc cggcctggcc       540
     gggagggggc cggggccgcg gcaggtaggg ccggccgcgg gctgagcgcg cctggtgtgg       600
     gtctgcagcg gaggcctcag caacctgctc ttccgctgct cgctcccgga ccacctgccc       660
     agcgttggcg aggagccccg ggaggtgctt ctgcggctgt acggagccat cttgcaggtg       720
     agggggttgt gagcgccgca gcaccagtgg ctttagggcc tgtcgcttac gcgatgcggg       780
     tagtattgtt cccgttgcgc agttgaggac accgaggttc acggtctgag taacacctca       840
     ttacaccgaa gcctgggcct gtattcccag agctttggga ggctgaggcg agaggatcac       900
     ttgagcacag gagttcgaga ccagcctgga caacatagtg agacccccat ctctaaataa       960
     aaatagacca acgctaaagc ctgtgctcca gagcctccag gcaattggat cagaagtcgc      1020
     agctctggtg ggaggaaggc gagccctcat gtgtgtccct gtgccacttt gccttggccc      1080
     ctttgctgtc catccttttt cagggcgtgg actccctggt gctagaaagc gtgatgttcg      1140
     ccatacttgc ggagcggtcg ctggggcccc agctgtacgg agtcttccca gagggccggc      1200
     tggaacagta catcccaagt cggccattga aaactcaaga gcttcgagag ccagtgttgt      1260
     cagcagccat tgccacgaag atggcgcaat ttcatggcat ggagatgcct ttcaccaagg      1320
     agccccactg gctgtttggg accatggagc ggtacctaaa acagatccag gacctgcccc      1380
     caactggcct ccctgagatg aacctgctgg agatgtacag cctgaaggat gagatgggca      1440
     acctcaggaa gttactagag tctaccccat cgccagtcgt cttctgccac aatgacatcc      1500
     aggaaggtag gagaaggcat ctgagtctcc taacccaaga tggaagagcc agagggctct      1560
     ggagtgagca gaacctcacc ccattccccc agggaacatc ttgctgctct cagagccaga      1620
     aaatgctgac agcctcatgc tggtggactt cgagtacagc agttataact ataggggctt      1680
     tgacattggg aaccattttt gtgagtgggt ttatgattat actcacgagg aatggccttt      1740
     ctacaaagca aggcccacag actaccccac tcaagaacag cagttgcatt ttattcgtca      1800
     ttacctggca gaggcaaaga aaggtgagac cctctcccaa gaggagcaga gaaaactgga      1860
     agaagatttg ctggtagaag tcagtcggta tgctctggca tcccatttct tctggggtct      1920
     gtggtccatc ctccaggcat ccatgtccac catagaattt ggttacttgg actatgccca      1980
     gtctcggttc cagttctact tccagcagaa ggggcagctg accagtgtcc actcctcatc      2040
     ctgactccac cctcccactc cttggatttc tcctggagcc tccagggcag gaccttggag      2100
     ggaggaacaa cgagcagaag gccctggcga ctgggctgag cccccaagtg aaactgaggt      2160
     tcaggagacc ggcctgttcc tgagtttgag tgccgaccaa cccccaggat ggcggaagct      2220
     caccaggccg tggccttcca gttcacggtg accccagacg gggtcgactt ccggctcagt      2280
     cgggaggccc tgaaacacgt ctacctgtct gggatcaact cctggaagaa acgcctgatc      2340
     cgcatcaaga atggcatcct caggggcgtg taccctggca gccccaccag ctggctggtc      2400
     gtcatcatgg caacagtggg ttcctccttc tgcaacgtgg acatctcctt ggggctggtc      2460
     agttgcatcc agagatgcct ccctcagggg tgtggcccct accagacccc gcagacccgg      2520
     gcacttctca gcatggccat cttctccacg ggcgtctggg tgacgggcat cttcttcttc      2580
     cgccaaaccc tgaagctgct tctctgctac catgggtgga tgtttgagat gcatggcaag      2640
     accagcaact tgaccaggat ctgggctatg tgtatccgcc ttctatccag ccggcaccct      2700
     atgctctaca gcttccagac atctctgccc aagcttcctg tgcccagggt gtcagccaca      2760
     attcagcggt acctagagtc tgtgcgcccc ttgttggatg atgaggaata ttaccgcatg      2820
     gagttgctgg ccaaagaatt ccaggacaag actgccccca ggctgcagaa atacctggtg      2880
     ctcaagtcat ggtgggcaag taactatgtg agtgactggt gggaagagta catctacctt      2940
     cgaggcagga gccctctcat ggtgaacagc aactattatg tcatggacct tgtgctcatc      3000
     aagaatacag acgtgcaggc agcccgcctg ggaaacatca tccacgccat gatcatgtat      3060
     cgccgtaaac tggaccgtga agaaatcaag cctgtgatgg cactgggcat agtgcctatg      3120
     tgctcctacc agatggagag gatgttcaac accactcgga tcccgggcaa ggacacagat      3180
     gtgctacagc acctctcaga cagccggcac gtggctgtct accacaaggg acgcttcttc      3240
     aagctgtggc tctatgaggg cgcccgtctg ctcaagcctc aggatctgga gatgcagttc      3300
     cagaggatcc tggacgaccc ctccccacct cagcctgggg aggagaagct ggcagccctc      3360
     actgcaggag gaagggtgga gtgggcgcag gcacgccagg ccttctttag ctctggaaag      3420
     aataaggctg ccttggaggc catcgagcgt gccgctttct tcgtggccct ggatgaggaa      3480
     tcctactcct atgaccccga agatgaggcc agcctcagcc tctatggcaa ggccctgcta      3540
     catggcaact gctacaacag gtggtttgac aaatccttca ctctcatttc cttcaagaat      3600
     ggccagttgg gtctcaatgc agagcatgcg tgggcagatg ctcccatcat tgggcacctc      3660
     tgggagtttg tcctgggcac agacagcttc cacctgggct acacggagac cgggcactgc      3720
     ctgggcaaac cgaaccctgc gctcgcacct cctacacggc tgcagtggga cattccaaaa      3780
     cagtgccagg cggtcatcaa gagttcctac caggtggcca aggcgttggc agacgacgtg      3840
     gagttgtact gcttccagtt cctgcccttt ggcaaaggcc tcatcaagaa gtgccggacc      3900
     agccctgatg cctttgtgca gatcgcgctg cagctggctc acttccgggg gtaagttctg      3960
     cctgacctat gaggcctcaa tgaccagaat gttccgggag ggacggactg agactgtgcg      4020
     ttcctgtacc agcgagtcca cagcctttgt gcaggccatg atggaggggt cccacacaaa      4080
     agcagacctg cgagatctct tccagaaggc tgctaagaag caccagaata tgtaccgcct      4140
     ggccatgacc ggggcaggga tcgacaggca cctcttctgc ctttacttgg tctccaagta      4200
     cctaggagtc agctctcctt tccttgctga ggtgctctcg gaaccctggc gtctctccac      4260
     cagccagatc ccccaatccc agatccgcat gttcgaccca gagcagcacc ccaatcacct      4320
     gggcgctgga ggtggctttg gccctgtagc agatgatggc tatggagttt cctacatgat      4380
     tgcaggcgag aacacgatct tcttccacat ctccagcaag ttctcaagct cagagacgaa      4440
     cgcccagcgc tttggaaacc acatccgcaa agccctgctg gacattgctg atcttttcca      4500
     agttcccaag gcctacagct gaaggttgga gaaatgccag ctgccctttc gtccccacac      4560
     tgtggaggaa gggacctgtg gcagctcaca ggcatgaggg gtggccgtgc acaggtgccc      4620
     aggctccaag gacagctccg gcagcaggtc ctcgctgggc agatgctgct ccctgagggc      4680
     ccaggtggtg gagcccttag gtacctgtgt tttgtttggg aactcggagg ccctccccct      4740
     cccccagctc agaccacaga ggtggcaaga gaagggctga agctggaaga ctgttcatga      4800
     gggacttgtg tgacctgctt tgaaatgtgt gactctgctg agtgacgtag gctctgagat      4860
     agctgtccac gcccacgtgt ttgcttggaa taaatacttg cctcag                     4906
//