Dbfetch

ID   AB049830; SV 1; linear; genomic DNA; STD; HUM; 270 BP.
XX
AC   AB049830;
XX
DT   14-OCT-2000 (Rel. 65, Created)
DT   17-JUN-2008 (Rel. 96, Last updated, Version 4)
XX
DE   Homo sapiens HLA-DRB1*1401V1 gene for MHC class II antigen, exon 2, partial
DE   cds.
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-270
RA   Juji T., Shimizu M., Kashiwase K., Tanaka H.;
RT   ;
RL   Submitted (11-OCT-2000) to the INSDC.
RL   Takeo Juji, Japanese Red Cross Central Blood Center, Research; Hiroo
RL   4-1-31, Shibuya-ku, Tokyo 150-0012, Japan (E-mail:juji@cbc.jrc.or.jp,
RL   Tel:81-3406-1211, Fax:81-3406-7892)
XX
RN   [2]
RA   Juji T., Shimizu M., Kashiwase K., Tanaka H.;
RT   "HLA-DRB1*1401V1";
RL   Unpublished.
XX
DR   MD5; 51ed7b0949546046424f0afc18c3ce21.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..270
FT                   /organism="Homo sapiens"
FT                   /mol_type="genomic DNA"
FT                   /note="HLA-type:A2/A31,B44/B51,DRB1*1302/DRB1*1401V1"
FT                   /db_xref="taxon:9606"
FT   CDS             <1..>270
FT                   /codon_start=3
FT                   /transl_table=1
FT                   /gene="HLA-DRB1"
FT                   /product="MHC class II antigen"
FT                   /note="allele:HLA-DRB1*1401V1"
FT                   /db_xref="GOA:Q9GIY3"
FT                   /db_xref="HGNC:HGNC:4948"
FT                   /db_xref="IMGT/HLA:DRB1*14:38:01"
FT                   /db_xref="InterPro:IPR000353"
FT                   /db_xref="InterPro:IPR003006"
FT                   /db_xref="InterPro:IPR003597"
FT                   /db_xref="InterPro:IPR007110"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR014745"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9GIY3"
FT                   /protein_id="BAB16682.1"
FT                   /translation="RFLEYSTSECHFFNGTERVRFLDRYFHNQEEFVRFDSDVGEYRAV
FT                   TELGRPAAEHWNSQKDLLERRRAEVDNYCRHNYGVVESFTVQRR"
FT   exon            1..270
FT                   /number=2
XX
SQ   Sequence 270 BP; 55 A; 64 C; 100 G; 51 T; 0 other;
     cacgtttctt ggagtactct acgtctgagt gtcatttctt caatgggacg gagcgggtgc        60
     ggttcctgga cagatacttc cataaccagg aggagttcgt gcgcttcgac agcgacgtgg       120
     gggagtaccg ggcggtgacg gagctggggc ggcctgctgc ggagcactgg aacagccaga       180
     aggacctcct ggagcggagg cgggccgagg tggacaatta ctgcagacac aactacgggg       240
     ttgtggagag cttcacagtg cagcggcgag                                        270
//