Dbfetch

ID   AB049459; SV 1; linear; genomic DNA; STD; HUM; 270 BP.
XX
AC   AB049459;
XX
DT   03-OCT-2000 (Rel. 65, Created)
DT   17-JUN-2008 (Rel. 96, Last updated, Version 4)
XX
DE   Homo sapiens HLA-DRB1-1307V gene for MHC class II antigen, partial cds.
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-270
RA   Kashiwase K., Shimizu M., Juji T., Tanaka H., Ishikawa Y.;
RT   ;
RL   Submitted (29-SEP-2000) to the INSDC.
RL   Kouichi Kashiwase, Japanese Red Cross Central Blood Center, Research; Hiroo
RL   4-1-31, Shibuya-ku 150-0012, Japan (E-mail:kasiwase@cbc.jrc.or.jp,
RL   Tel:81-3406-1211, Fax:81-3406-7892)
XX
RN   [2]
RA   Kashiwase K., Shimizu M., Juji T., Tanaka H., Ishikawa Y.;
RT   "HLA-DRB1-1307V for exon2";
RL   Unpublished.
XX
DR   MD5; 2b9bd330df702f7656471ef069deb7f9.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..270
FT                   /organism="Homo sapiens"
FT                   /mol_type="genomic DNA"
FT                   /note="DNA-No:12184"
FT                   /note="HLA type:A2/A11.1,B7/B48,Cw7,DRB1*0101/DRB1*1307V"
FT                   /db_xref="taxon:9606"
FT   CDS             <1..>270
FT                   /codon_start=3
FT                   /transl_table=1
FT                   /product="MHC class II antigen"
FT                   /note="allele:HLA-DRB1-1307V"
FT                   /db_xref="GOA:Q5Y7A7"
FT                   /db_xref="HGNC:HGNC:4948"
FT                   /db_xref="IMGT/HLA:DRB1*13:47"
FT                   /db_xref="InterPro:IPR000353"
FT                   /db_xref="InterPro:IPR003006"
FT                   /db_xref="InterPro:IPR003597"
FT                   /db_xref="InterPro:IPR007110"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR014745"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5Y7A7"
FT                   /protein_id="BAB16298.1"
FT                   /translation="RFLEYSTSECHFFNGTERVRFLDRYFYNQEEYVRFDSDVGEYRAV
FT                   TELGRPDAEYWNSQKDFLEDRRALVDTYCRHNYGVGESFTVQRR"
FT   exon            1..270
FT                   /number=2
XX
SQ   Sequence 270 BP; 57 A; 64 C; 96 G; 53 T; 0 other;
     cacgtttctt ggagtactct acgtctgagt gtcatttctt caatgggacg gagcgggtgc        60
     ggttcctgga cagatacttc tataaccaag aggagtacgt gcgcttcgac agcgacgtgg       120
     gggagtaccg ggcggtgacg gagctggggc ggcctgatgc cgagtactgg aacagccaga       180
     aggacttcct ggaagacagg cgggccctgg tggacaccta ctgcagacac aactacgggg       240
     ttggtgagag cttcacggtg cagcggcgag                                        270
//