Dbfetch

ID   AB049137; SV 1; linear; mRNA; STD; MUS; 2218 BP.
XX
AC   AB049137;
XX
DT   23-SEP-2000 (Rel. 65, Created)
DT   23-SEP-2008 (Rel. 97, Last updated, Version 2)
XX
DE   Mus musculus mRNA for novel cytokine receptor NR8, complete cds.
XX
KW   .
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi; Muroidea;
OC   Muridae; Murinae; Mus; Mus.
XX
RN   [1]
RP   1-2218
RA   Nomura H., Yaguchi N., Maeda M., Hasegawa M.;
RT   ;
RL   Submitted (20-SEP-2000) to the INSDC.
RL   Hitoshi Nomura, CHUGAI Research Institute for Molecular Medicine Inc.,
RL   Cytokine Discovery Group; 153-2, Nagai, Niihari, Ibaraki 300-4101, Japan
RL   (E-mail:nomurah@cimmed.com, Tel:81-298-30-6211, Fax:81-298-30-6270)
XX
RN   [2]
RA   Nomura H., Yaguchi N., Maeda M., Hasegawa M.;
RT   "A novel cytokine receptor NR8 is closely mapped to IL-4R: Polymorphism in
RT   Balb/c mouse.";
RL   Unpublished.
XX
DR   MD5; f08512b0f6cceb13ed518b00168a556d.
DR   Ensembl-Gn; ENSMUSG00000030745; mus_musculus.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0032969; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_AJ_G0032952; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AKRJ_G0032884; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_BALBcJ_G0032957; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_C3HHeJ_G0032667; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0033463; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_CASTEiJ_G0031995; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CBAJ_G0032640; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_DBA2J_G0032792; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_FVBNJ_G0032745; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_LPJ_G0032886; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0032777; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0033483; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0031703; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_WSBEiJ_G0032108; mus_musculus_wsbeij.
DR   Ensembl-Tr; ENSMUST00000033000; mus_musculus.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0086380; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_AJ_T0086463; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AKRJ_T0086402; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_BALBcJ_T0086424; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_C3HHeJ_T0085986; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0086919; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_CASTEiJ_T0086501; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CBAJ_T0085926; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_DBA2J_T0086123; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_FVBNJ_T0085964; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_LPJ_T0086158; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0086005; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0087212; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0085914; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_WSBEiJ_T0085026; mus_musculus_wsbeij.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..2218
FT                   /organism="Mus musculus"
FT                   /chromosome="7"
FT                   /strain="Balb/c"
FT                   /mol_type="mRNA"
FT                   /db_xref="taxon:10090"
FT   CDS             331..1920
FT                   /codon_start=1
FT                   /transl_table=1
FT                   /gene="NR8"
FT                   /product="novel cytokine receptor NR8"
FT                   /db_xref="GOA:Q9JHX3"
FT                   /db_xref="InterPro:IPR003531"
FT                   /db_xref="InterPro:IPR003961"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="MGI:MGI:1890475"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9JHX3"
FT                   /protein_id="BAB13736.1"
FT                   /translation="MPRGPVAALLLLILHGAWSCLDLTCYTDYLWTITCVLETRSPNPS
FT                   ILSLTWQDEYEELQDQETFCSLHKSGHNTTHIWYTCHMRLSQFLSDEVFIVNVTDQSGN
FT                   NSQECGSFVLAESIKPAPPLNVTVAFSGRYDISWDSAYDEPSNYVLRGKLQYELQYRNL
FT                   RDPYAVRPVTKLISVDSRNVSLLPEEFHKDSSYQLQMRAAPQPGTSFRGTWSEWSDPVI
FT                   FQTQAGEPEAGWDPHMLLLLAVLIIVLVFMGLKIHLPWRLWKKIWAPVPTPESFFQPLY
FT                   REHSGNFKKWVNTPFTASSIELVPQSSTTTSALHLSLYPAKEKKFPGLPGLEEQLECDG
FT                   MSEPGHWCIIPLAAGQAVSAYSEERDRPYGLVSIDTVTVGDAEGLCVWPCSCEDDGYPA
FT                   MNLDAGRESGPNSEDLLLVTDPAFLSCGCVSGSGLRLGGSPGSLLDRLRLSFAKEGDWT
FT                   ADPTWRTGSPGGGSESEAGSPPGLDMDTFDSGFAGSDCGSPVETDEGPPRSYLRQWVVR
FT                   TPPPVDSGAQSS"
FT   STS             1968..2058
FT                   /standard_name="D7Mit101"
XX
SQ   Sequence 2218 BP; 487 A; 614 C; 596 G; 521 T; 0 other;
     gtctgcccat ccctggggca gccaactggc ctcagcccgt gccccaggcg tgccctgtct        60
     ctgtctggct gccccagccc tactgtcttc ctctgtgtag gctctgccca gatgcccggc       120
     tggtcctcag cctcaggact atctcagcag tgactcccct gattctggac ttgcacctga       180
     ctgaactcct gcccacctca aaccttcacc tcccaccacc accactccga gtcccgctgt       240
     gactcccacg cccaggagac cacccaagtg ccccagcgta aagaatggct ttctgaggaa       300
     gatcctgaag gagtaggtct gggacacagc atgccccggg gcccagtggc tgccttactc       360
     ctgctgattc tccatggagc ttggagctgc ctggacctca cttgctacac tgactacctc       420
     tggaccatca cctgtgtcct ggagacacgg agccccaacc ccagcatact cagtctcacc       480
     tggcaagatg aatatgagga acttcaggac caagagacct tctgcagcct acacaagtct       540
     ggccacaaca ccacacatat atggtacacg tgccatatgc gcttgtctca attcctgtcc       600
     gatgaagttt tcattgtcaa cgtgacggac cagtctggca acaactccca agagtgtggc       660
     agctttgtcc tggctgagag catcaagcca gctcccccct tgaacgtgac tgtggccttc       720
     tcaggacgct atgatatctc ctgggactca gcttatgacg aaccctccaa ctacgtgctg       780
     agaggcaagc tacaatatga gctgcagtat cggaacctca gagaccccta tgctgtgagg       840
     ccggtgacca agctgatctc agtggactca agaaacgtct ctcttctccc tgaagagttc       900
     cacaaagatt ctagctacca gctgcagatg cgggcagcgc ctcagccagg cacttcattc       960
     agggggacct ggagtgagtg gagtgacccc gtcatctttc agacccaggc tggggagccc      1020
     gaggcaggct gggaccctca catgctgctg ctcctggctg tcttgatcat tgtcctggtt      1080
     ttcatgggtc tgaagatcca cctgccttgg aggctatgga aaaagatatg ggcaccagtg      1140
     cccacccctg agagtttctt ccagcccctg tacagggagc acagcgggaa cttcaagaaa      1200
     tgggttaata cccctttcac ggcctccagc atagagttgg tgccacagag ttccacaaca      1260
     acatcagcct tacatctgtc attgtatcca gccaaggaga agaagttccc ggggctgccg      1320
     ggtctggaag agcaactgga gtgtgatgga atgtctgagc ctggtcactg gtgcataatc      1380
     cccttggcag ctggccaagc ggtctcagcc tacagtgagg agagagaccg gccatatggt      1440
     ctggtgtcca ttgacacagt gactgtggga gatgcagagg gcctgtgtgt ctggccctgt      1500
     agctgtgagg atgatggcta tccagccatg aacctggatg ctggcagaga gtctggtcct      1560
     aattcagagg atctgctctt ggtcacagac cctgcttttc tgtcttgtgg ctgtgtctca      1620
     ggtagtggtc tcaggcttgg gggctcccca ggcagcctac tggacaggtt gaggctgtca      1680
     tttgcaaagg aaggggactg gacagcagac ccaacctgga gaactgggtc cccaggaggg      1740
     ggctctgaga gtgaagcagg ttccccccct ggtctggaca tggacacatt tgacagtggc      1800
     tttgcaggtt cagactgtgg cagccccgtg gagactgatg aaggaccccc tcgaagctat      1860
     ctccgccagt gggtggtcag gacccctcca cctgtggaca gtggagccca gagcagctag      1920
     catataataa ccagctgtag tgagaagagg cctctgagcc tggcatttac agtgtgaaca      1980
     tgtaggggtg tgtgtgtgtg tgtgtgtgtg tgtgtgtgtg tgtgtcttgg gttgtgtgtt      2040
     agcacatcca tgttgggatt tggtctgttg ctatgtattg taatgctaaa ttctctaccc      2100
     aaagttctag gcctacgagt gaattctcgt gtttacaaac ttgctgtgta aaccttgttc      2160
     cttaatttaa ttccattggt taaataaaat tggctgcaac caaaaaaaaa aaaaaaaa        2218
//