spacer

EBI Dbfetch

ID   AB047552; SV 1; linear; mRNA; STD; MUS; 2970 BP.
XX
AC   AB047552;
XX
DT   23-AUG-2000 (Rel. 64, Created)
DT   23-SEP-2008 (Rel. 97, Last updated, Version 3)
XX
DE   Mus musculus mRNA for VEGF induced aminopeptidase, complete cds.
XX
KW   .
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi; Muroidea;
OC   Muridae; Murinae; Mus; Mus.
XX
RN   [1]
RP   1-2970
RA   Miyashita H., Sato Y.;
RT   ;
RL   Submitted (21-AUG-2000) to the INSDC.
RL   Hiroki Miyashita, Tohoku University, Institute of Development, Aging and
RL   Cancer, Department of Vascular Biology; 4-1 Seiryoumachi, Aoba-ku, Sendai
RL   980-8575, Japan (E-mail:miyashita80@hotmail.com, Tel:81-22-717-8532,
RL   Fax:81-22-717-8533)
XX
RN   [2]
RX   DOI; 10.1182/blood.V99.9.3241.
RX   PUBMED; 11964289.
RA   Miyashita H., Yamazaki T., Akada T., Niizeki O., Ogawa M., Nishikawa S.,
RA   Sato Y.;
RT   "A mouse orthologue of puromycin-insensitive leucyl-specific aminopeptidase
RT   is expressed in endothelial cells and plays an important role in
RT   angiogenesis";
RL   Blood 99(9):3241-3249(2002).
XX
DR   MD5; 3ef2e79ffb4f2d328c2a8edca5b8a8ee.
DR   Ensembl-Gn; ENSMUSG00000021583; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000169114; mus_musculus.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..2970
FT                   /organism="Mus musculus"
FT                   /mol_type="mRNA"
FT                   /db_xref="taxon:10090"
FT   CDS             64..2856
FT                   /codon_start=1
FT                   /transl_table=1
FT                   /product="VEGF induced aminopeptidase"
FT                   /db_xref="GOA:Q9EQH2"
FT                   /db_xref="InterPro:IPR001930"
FT                   /db_xref="InterPro:IPR014782"
FT                   /db_xref="InterPro:IPR024571"
FT                   /db_xref="MGI:MGI:1933403"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9EQH2"
FT                   /protein_id="BAB11982.1"
FT                   /translation="MPSLLPLVLTFLSVSSPSWCQNSDIESLKASNGDSFPWNNMRLPE
FT                   YMTPIHYDLMIHANLSTLTFWGKTEVEIIASRPTSTIIMHSHHLQISKATLRRGAGEML
FT                   SEEPLKVLEYPAHEQVALLAAQPLLAGSLYTVIIDYAANLSESFHGFYKSTYRTQEGEM
FT                   RILAATQFEPTAARMAFPCFDEPALKASFSIKIKRDPRHLAISNMPLVKSVNVAEGLIE
FT                   DHFDITVKMSTYLVAFIISDFKSVSKMTKSGVKVSVYAVPDKINQADYALDAAVTLLEF
FT                   YEDYFNIPYPLPKQDLAAIPDFQSGAMENWGLTTYRESSLLYDKEKSSASSKLGITMIV
FT                   SHELAHQWFGNLVTMEWWNDLWLNEGFAKFMEFVSVTVTHPELKVEDYFFGKCFNAMEV
FT                   DALNSSHPVSTPVENPAQIREMFDDVSYEKGACILNMLRDYLSADTFKRGIVQYLQKYS
FT                   YKNTKNEDLWNSMMHICPTDGTQTMDGFCSRSQHSSSTSHWRQEVVDVKTMMNTWTLQK
FT                   GFPLITITVSGRNVHMKQEHYMKGSERFPETGYLWHVPLTFITSKSDSVQRFLLKTKTD
FT                   VLILPEAVQWIKFNVGMNGYYIVHYADDGWASLSGLLKEAHTTISSNDRASLINNAFQL
FT                   VSIEKLSIEKALDLTLYLKNETEIMPIFQALNELIPMYKLMEKRDMIEVETQFKDFLLK
FT                   LLKDLIDKQTWTDEGSVSERMLRSQLLLLACVRNYQPCVQRAERYFREWKSSNGNMSIP
FT                   IDVTLAVFAVGAQNTEGWDFLYSKYQSSLSSTEKSQIEFSLCTSKDPEKLQWLLDQSFK
FT                   GEIIKTQEFPHILTLIGRNPVGYPLAWKFLRENWNKLVQKFELGSSSIAHMVMGTTDQF
FT                   STRARLEEVKGFFSSLKENGSQLRCVQQTIETIEENIRWMDKNFDKIRLWLQKEKPELL
FT                   "
XX
SQ   Sequence 2970 BP; 905 A; 610 C; 650 G; 805 T; 0 other;
     gtgatgaagg taaatttgag caagaagata gtgtctctgc tcctcaaata gccacttgca        60
     agcatgccct ctcttcttcc cctagtattg acatttttat ctgtgtcatc tccttcttgg       120
     tgtcagaaca gtgatataga atctctaaaa gctagtaatg gagactcatt cccttggaat       180
     aatatgcgac ttcctgagta tatgaccccg attcattatg atctcatgat ccatgcaaac       240
     ctcagcactc tgactttctg gggaaaaaca gaagtagaaa tcatagctag ccggcccacc       300
     agcaccatta ttatgcatag tcaccacctg caaatatcta aggccaccct cagaagagga       360
     gctggagaga tgctgtctga agaaccactg aaggtcctgg aatatcctgc tcatgagcaa       420
     gttgcactgc tggctgccca gccgcttctt gctgggtccc tgtacacagt tatcatcgac       480
     tatgctgcca acctgtctga gagtttccat ggattctata agagcaccta cagaacacag       540
     gaaggtgaaa tgagaatact tgcagcaaca cagtttgaac ccacagctgc tagaatggct       600
     tttccctgct ttgatgaacc tgccctcaag gcaagttttt ccatcaagat aaagagggat       660
     ccaaggcacc tggccatctc caacatgccc ctggtgaaat ctgtgaatgt tgctgaagga       720
     ctcatagaag accattttga catcactgtg aagatgagta cctacctagt ggccttcatc       780
     atttctgatt ttaagtctgt gagcaagatg actaagagtg gagtcaaggt ttctgtgtat       840
     gctgtgccag acaagataaa tcaagccgat tatgctctgg atgctgcagt gactcttcta       900
     gagttttatg aggattattt caacattcca tatcctttac ccaagcaaga tcttgctgca       960
     atcccagact ttcagtctgg tgctatggaa aactggggac tgaccacata cagagagtcc      1020
     tctctgttat acgataaaga aaagtcttct gcatctagta agcttggcat cacaatgatt      1080
     gtgtcccatg aactggctca ccagtggttc gggaacctgg tcaccatgga atggtggaat      1140
     gacctttggc tcaatgaagg atttgccaaa tttatggagt ttgtgtctgt cactgtgacc      1200
     catcctgaac taaaagttga agactatttc tttggcaagt gttttaatgc aatggaagtt      1260
     gatgcattaa actcctctca ccctgtatcc acacctgtgg agaatcctgc gcagattcgg      1320
     gagatgtttg atgatgtttc ttatgaaaag ggagcttgta ttctgaatat gctaagagat      1380
     tatctgagtg cagatacatt taaaagagga attgtacagt atctccaaaa gtatagttat      1440
     aaaaacacaa aaaacgagga cctgtggaat agcatgatgc atatttgccc tacagatggc      1500
     acacaaacaa tggatggctt ctgctctaga agccaacact catcatcaac ctcacactgg      1560
     cgtcaggagg ttgtagatgt aaagaccatg atgaacacat ggacactgca gaagggcttt      1620
     cctctgataa ccatcactgt gagtgggcgg aatgtgcaca tgaagcaaga acactacatg      1680
     aagggttcag aacgcttccc agagactggg tatttgtggc atgttccact gacattcatt      1740
     accagcaaat cagactcagt ccagagattt ttgctgaaga caaagacaga tgtgctcatc      1800
     ctcccagaag cagtgcagtg gatcaaattt aacgtgggaa tgaatggcta ttacattgtg      1860
     cattacgcgg atgatggatg ggcttctctg agtggccttt taaaagaagc gcacacaaca      1920
     atcagcagta atgatcgggc aagtctcatc aacaatgcat ttcagctggt cagcattgaa      1980
     aagttatcaa tagaaaaagc cctggattta accctgtact tgaaaaatga aactgaaatt      2040
     atgcccatat tccaagcttt gaatgaactc atacctatgt ataagttaat ggagaaaaga      2100
     gatatgattg aggtggaaac tcaatttaag gacttccttc tcaagttgct gaaggacctt      2160
     attgataagc agacttggac agatgaaggc tctgtctcag agaggatgct caggagccag      2220
     ctcctcctcc tcgcatgtgt gcgcaattat cagccctgtg tgcagagggc agagcgctat      2280
     ttcagagagt ggaagtcatc taatggaaac atgagcatcc ctattgatgt gaccttggct      2340
     gtgtttgctg tcggggccca aaacacagaa ggctgggatt ttctttatag taaatatcag      2400
     tcttctttgt ctagtactga gaaaagccaa attgaatttt ccctctgtac aagcaaagat      2460
     ccagaaaaac ttcagtggct tctagatcaa agttttaagg gagagataat aaaaactcag      2520
     gaatttccac atattctcac actcattggc agaaacccag tgggttatcc attggcctgg      2580
     aagtttctga gggaaaattg gaataagctt gtacagaaat ttgaacttgg ctcatcgtcc      2640
     atagctcaca tggtaatggg aacaacagac cagttttcca ccagagcacg tcttgaagag      2700
     gtaaaaggat tcttcagttc cttgaaagaa aacggttctc agctccgttg tgttcaacaa      2760
     accattgaga ccattgaaga aaacatacga tggatggata agaattttga taaaataaga      2820
     ctgtggctgc aaaaagaaaa gccagagttg ctgtgacaat atgtttcttg ccaagttcca      2880
     gaatttatga tgagcaaaat tttgttcaat ttgagtattt ttaaactaaa gatagttgtt      2940
     ttggctcacg aaaaaaaaaa aaaaaaaaaa                                       2970
//


spacer
spacer