spacer

EBI Dbfetch

ID   AB039157; SV 1; linear; genomic DNA; STD; MUS; 996 BP.
XX
AC   AB039157;
XX
DT   02-OCT-2001 (Rel. 69, Created)
DT   15-APR-2008 (Rel. 95, Last updated, Version 2)
XX
DE   Mus musculus b3GT3 gene for UDP-Gal:betaGlcNAc beta
DE   1,3-galactosyltransferase III, complete cds, strain:CAST/Ei.
XX
KW   b3GT3; UDP-Gal:betaGlcNAc beta 1,3-galactosyltransferase III.
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi; Muroidea;
OC   Muridae; Murinae; Mus; Mus.
XX
RN   [1]
RP   1-996
RA   Liu Y., Saitou N.;
RT   ;
RL   Submitted (29-FEB-2000) to the INSDC.
RL   Contact:Naruya Saitou National Institute of Genetics, Laboratory of
RL   Evolutionary Genetics; 1111 Yata, Mishima, Shizuoka 411-8540, Japan URL   
RL   :http://sayer.lab.nig.ac.jp/
XX
RN   [2]
RX   DOI; 10.1266/ggs.83.77.
RX   PUBMED; 18379136.
RA   Liu Y., Takahashi A., Kitano T., Koide T., Shiroishi T., Moriwaki K.,
RA   Saitou N.;
RT   "Mosaic genealogy of the Mus musculus genome revealed by 21 nuclear genes
RT   from its three subspecies";
RL   Genes Genet. Syst. 83(1):77-88(2008).
XX
DR   MD5; 5e8c808edcabeadc93e4f0e5b784b112.
DR   Ensembl-Gn; ENSMUSG00000043300; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000061826; mus_musculus.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..996
FT                   /organism="Mus musculus"
FT                   /sub_species="castaneus"
FT                   /strain="CAST/Ei"
FT                   /mol_type="genomic DNA"
FT                   /note="sequence used for primer design based on
FT                   Acc#AF029792"
FT                   /db_xref="taxon:10090"
FT   CDS             1..996
FT                   /codon_start=1
FT                   /gene="b3GT3"
FT                   /product="UDP-Gal:betaGlcNAc beta 1,3-galactosyltransferase
FT                   III"
FT                   /db_xref="GOA:Q920V1"
FT                   /db_xref="InterPro:IPR002659"
FT                   /db_xref="MGI:MGI:1349405"
FT                   /protein_id="BAB68681.1"
FT                   /translation="MAPAVLTALPNRMSLRSLKWSLLLLSLLSFLVIWYLSLPHYNVIE
FT                   RVNWMYFYEYEPIYRQDFRFTLREHSNCSHQNPFLVILVTSRPSDVKARQAIRVTWGEK
FT                   KSWWGYEVLTFFLLGQQAEREDKMLALSLEDEHVLYGDIIRQDFLDTYNNLTLKTIMAF
FT                   RWVMEFCPNAKYIMKTDTDVFINTGNLVKYLLNLNHSEKFFTGYPLIDNYSYRGFFHKN
FT                   HISYQEYPFKVFPPYCSGLGYIMSGDLVPRVYEMMSHVKPIKFEDVYVGICLNLLKVDI
FT                   HIPEDTNLFFLYRIHLDVCQLRRVIAAHGFSSKEIITFWQVMLRNTTCHY"
XX
SQ   Sequence 996 BP; 262 A; 243 C; 215 G; 276 T; 0 other;
     atggccccgg ctgtcttgac tgcccttccc aataggatgt cactgagatc cctcaagtgg        60
     agcctgctgc tgctgtccct gctgagcttc ctggtgatat ggtacctcag cctcccccac       120
     tacaatgtga tcgagcgcgt caactggatg tacttctatg agtatgagcc aatttacaga       180
     caagactttc gcttcacgct ccgcgaacac tcgaactgtt ctcatcagaa cccattcctg       240
     gtcatcctgg tgacctcacg cccctcagat gtgaaagcca gacaagccat tagagttact       300
     tggggtgaga aaaagtcctg gtggggatat gaggtgctca catttttctt actaggccag       360
     caggctgaaa gggaagacaa aatgttagcc ctgtccttgg aggacgagca cgttctctat       420
     ggtgatatta tacggcaaga ctttctagac acatataata acttgacctt gaaaaccatt       480
     atggctttca ggtgggtaat ggaattttgc cccaatgcca agtatatcat gaaaacagac       540
     actgatgttt tcatcaacac tggcaattta gtcaagtatc ttttaaacct aaaccactca       600
     gagaagtttt tcacgggcta tcctctaatt gataactatt cctatagagg atttttccat       660
     aaaaaccaca tttcatacca agagtacccc ttcaaggtgt tccctcccta ctgcagcggg       720
     ctgggctaca ttatgtccgg cgacctggtg cccagggtct acgagatgat gagtcacgtg       780
     aagcccatca agtttgaaga cgtttatgtt ggcatttgtt tgaatttgtt aaaagtggac       840
     attcatattc cagaagacac aaaccttttc tttctgtaca gaatccactt ggatgtatgt       900
     cagctcagac gcgtgattgc agcccatggc ttttcttcca aggagatcat cacattctgg       960
     caggtgatgc tgaggaacac cacatgccat tactaa                                 996
//


spacer
spacer