spacer

EBI Dbfetch

ID   AB039149; SV 1; linear; genomic DNA; STD; MUS; 1228 BP.
XX
AC   AB039149;
XX
DT   02-OCT-2001 (Rel. 69, Created)
DT   15-APR-2008 (Rel. 95, Last updated, Version 3)
XX
DE   Mus musculus b3GT2 gene for UDP-Gal:betaGlcNAc beta
DE   1,3-galactosyltransferase II, partial cds, strain:pgn2.
XX
KW   b3GT2; UDP-Gal:betaGlcNAc beta 1,3-galactosyltransferase II.
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi; Muroidea;
OC   Muridae; Murinae; Mus; Mus.
XX
RN   [1]
RP   1-1228
RA   Liu Y., Saitou N.;
RT   ;
RL   Submitted (29-FEB-2000) to the INSDC.
RL   Contact:Naruya Saitou National Institute of Genetics, Laboratory of
RL   Evolutionary Genetics; 1111 Yata, Mishima, Shizuoka 411-8540, Japan URL   
RL   :http://sayer.lab.nig.ac.jp/
XX
RN   [2]
RX   DOI; 10.1266/ggs.83.77.
RX   PUBMED; 18379136.
RA   Liu Y., Takahashi A., Kitano T., Koide T., Shiroishi T., Moriwaki K.,
RA   Saitou N.;
RT   "Mosaic genealogy of the Mus musculus genome revealed by 21 nuclear genes
RT   from its three subspecies";
RL   Genes Genet. Syst. 83(1):77-88(2008).
XX
DR   MD5; 84299fdcc9495ebc080d77df55c5c4f3.
DR   Ensembl-Gn; ENSMUSG00000033849; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000038252; mus_musculus.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1228
FT                   /organism="Mus musculus"
FT                   /sub_species="domesticus"
FT                   /strain="pgn2"
FT                   /mol_type="genomic DNA"
FT                   /note="sequence used for primer design based on
FT                   Acc#AF029791"
FT                   /db_xref="taxon:10090"
FT   CDS             <1..>1228
FT                   /codon_start=1
FT                   /gene="b3GT2"
FT                   /product="UDP-Gal:betaGlcNAc beta 1,3-galactosyltransferase
FT                   II"
FT                   /db_xref="GOA:O54905"
FT                   /db_xref="InterPro:IPR002659"
FT                   /db_xref="MGI:MGI:1349461"
FT                   /db_xref="UniProtKB/Swiss-Prot:O54905"
FT                   /protein_id="BAB68673.1"
FT                   /translation="RHCCFAKMTWSPKRSLLRTPLTGVLSLVFLFAMFLFFNHHDWLPG
FT                   RPGFKENPVTYTFRGFRSTKSETNHSSLRTIWKEVAPQTLRPHTASNSSNTELSPQGVT
FT                   GLQNTLSANGSIYNEKGTGHPNSYHFKYIINEPEKCQEKSPFLILLIAAEPGQIEARRA
FT                   IRQTWGNETLAPGIQIIRVFLLGISIKLNGYLQHAIQEESRQYHDIIQQEYLDTYYNLT
FT                   IKTLMGMNWVATYCPHTPYVMKTDSDMFVNTEYLIHKLLKPDLPPRHNYFTGYLMRGYA
FT                   PNRNKDSKWYMPPDLYPSERYPVFCSGTGYVFSGDLAEKIFKVSLGIRRLHLEDVYVGI
FT                   CLAKLRVDPVPPPNEFVFNHWRVSYSSCKYSHLITSHQFQPSELIKYWNHLQQNKHNAC
FT                   ANAAKEKAGR"
XX
SQ   Sequence 1228 BP; 386 A; 275 C; 244 G; 323 T; 0 other;
     cgacactgct gctttgcaaa aatgacctgg agccctaaga ggtctctgct ccggactccc        60
     cttacgggtg tgctttctct agtgtttctc tttgctatgt tcttgttttt caatcatcat       120
     gactggttac caggtagacc aggattcaaa gaaaatcctg tgacatacac tttccgagga       180
     tttcgttcta caaaaagtga gacaaaccat agctcccttc ggaccatctg gaaagaagta       240
     gctcctcaga ctctgaggcc tcacacagca agcaactcca gtaacaccga gctatcacca       300
     cagggagtca cagggctgca gaacactctc agtgccaatg gcagcattta taatgaaaaa       360
     ggaactggac atccaaactc ttaccatttc aaatatatta tcaatgagcc tgaaaaatgc       420
     caagagaaaa gtccattttt aatactatta atagctgcag aacctggaca aatcgaagca       480
     agaagagcta tacggcaaac ttggggcaat gaaactttgg cacctggcat ccaaatcata       540
     cgggtttttt tgttgggcat aagtattaag ctaaatggct atcttcaaca tgcaattcaa       600
     gaagaaagca gacagtatca tgatataatt cagcaggaat atttagatac atactataat       660
     ctgaccatta aaacactaat gggtatgaac tgggttgcaa catactgtcc acatactccc       720
     tatgttatga aaacggacag tgacatgttt gtcaacacag aatacttaat acacaagtta       780
     ctaaagccag acctgcctcc tagacataac tattttactg gctatctaat gagaggatat       840
     gcaccgaaca gaaacaaaga cagtaagtgg tacatgccac cagaccttta cccaagtgag       900
     cgctaccctg tcttctgctc aggaactggt tatgtgtttt ctggggatct ggcagagaag       960
     atatttaagg tttctttagg tatccgtcgt ttgcacttgg aagatgtata tgtagggatc      1020
     tgtcttgcca agttgagagt tgatcctgtg ccccctccca atgagttcgt gttcaatcac      1080
     tggcgagttt cttattcaag ctgtaaatac agccacctaa ttacctctca tcagttccaa      1140
     cctagtgaac tgataaaata ctggaaccat ttacaacaaa ataagcacaa cgcctgtgcc      1200
     aatgcagcaa aggaaaaggc aggcaggt                                         1228
//


spacer
spacer