spacer

EBI Dbfetch

ID   AB035511; SV 1; linear; mRNA; STD; MUS; 2402 BP.
XX
AC   AB035511;
XX
DT   03-OCT-2000 (Rel. 65, Created)
DT   23-SEP-2008 (Rel. 97, Last updated, Version 2)
XX
DE   Mus musculus LU mRNA for Lutheran antigen, complete cds.
XX
KW   Lutheran antigen.
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi; Muroidea;
OC   Muridae; Murinae; Mus; Mus.
XX
RN   [1]
RP   1-2402
RA   Taira E., Okumura S., Miki N.;
RT   ;
RL   Submitted (03-DEC-1999) to the INSDC.
RL   Eiichi Taira, Osaka University Medical School, Department of Pharmacology;
RL   2-2 Yamada-oka, Suita, Osaka 565-0871, Japan
RL   (E-mail:etaira@pharma1.med.osaka-u.ac.jp, Tel:+81-6-6879-3521,
RL   Fax:+81-6-6879-3521)
XX
RN   [2]
RP   1-2402
RA   Taira E., Okumura S., Miki N.;
RT   "mouse Lutheran antigen";
RL   Unpublished.
XX
DR   MD5; 54fa91ca62f28e1ac313bd606e11b609.
DR   Ensembl-Gn; ENSMUSG00000002980; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000003061; mus_musculus.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..2402
FT                   /organism="Mus musculus"
FT                   /strain="BALB/c"
FT                   /mol_type="mRNA"
FT                   /db_xref="taxon:10090"
FT   CDS             24..1892
FT                   /codon_start=1
FT                   /transl_table=1
FT                   /gene="LU"
FT                   /product="Lutheran antigen"
FT                   /db_xref="GOA:Q9R069"
FT                   /db_xref="InterPro:IPR003598"
FT                   /db_xref="InterPro:IPR003599"
FT                   /db_xref="InterPro:IPR007110"
FT                   /db_xref="InterPro:IPR013162"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="MGI:MGI:1929940"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9R069"
FT                   /protein_id="BAB16053.1"
FT                   /translation="MEPPDARAGLLWLTFLLSGYSGAQAELHVSVPPRVEVMRGEQVAL
FT                   DCTPREHPEHYVLEWFLVDGTGARHRLASVEPQGSEFLGTVHSLGRVPPYEVDSRGRLV
FT                   IAKVQVGDGRDYVCVVKAGAAGTSEATSSVRVFATPEDTEVSPNKGTLSVMDQFAQEIA
FT                   TCSSNNGNPVPRITWYRNGQRLEVPMEVNQKGYITIRTVREASGLYSLTSTLYLRLHKD
FT                   DRDANFHCAAHYDLPSGQHGRLDSHTFRLTLHYPTEHVEFWVGSPSTTEGWVREGDAVQ
FT                   LLCQGDGSPSPEYSFFRQQGTQEEQLNVNLKGNLTLEGVHRNQSGIYGCRVEDYDADEE
FT                   VQLVKKLKLHVAYLDPLELSVPEELFVFLNSSSTVVNCSARGLPTPTARWTKDSVTLAD
FT                   GPMLSLQSVTFDSAGTYTCEASTPTVPLLSRTQSFQLIVQGAPELKPNEIMPKSGNSWT
FT                   EGDEVMLTCSARGFPEPKLTWSQRGDTPAEPPFEGRGWKSSSLMVKVTSALSREGVSCE
FT                   ASNIHGKKGHVFHFGSVAPQTAQAGVAVMAVAVSVGLLLLVVAAFYCMRRKGRPGCCRR
FT                   AEKGAPPAREPELSHSGSERPEHTGLLMGGPSGGGRGGSGGFGDEC"
XX
SQ   Sequence 2402 BP; 510 A; 717 C; 716 G; 459 T; 0 other;
     cgcccgggca ggttgcaggg aacatggaac cccctgacgc ccgcgcaggg ctgctgtggc        60
     tcaccttcct gctgtcgggc tactcaggtg cccaggctga gctgcacgtg tccgtgcccc       120
     cacgggtgga ggtgatgcga ggcgagcaag tcgccctgga ctgcactcca cgggagcacc       180
     ctgagcatta cgtgctggaa tggttcctcg ttgatggtac tggggctcga caccgtctgg       240
     cttctgtgga accacagggc tcagagttcc tgggcacagt ccactctctg ggccgcgtac       300
     ccccatacga ggtagactct cgtgggcgcc tggtgatagc aaaggtccag gtgggcgatg       360
     gacgggacta cgtgtgcgta gtgaaggctg gggcagcggg tacctcagag gccacctcaa       420
     gtgtccgtgt gtttgcaaca ccagaggata cggaggtgtc tcccaacaaa gggacgctgt       480
     ctgtgatgga ccagtttgcc caggagattg ccacctgcag cagcaacaac ggaaaccccg       540
     tgcctcggat cacatggtac cgaaacgggc agcgtctgga agtacccatg gaggtgaacc       600
     aaaagggcta cataaccatc cgtactgtcc gggaagcctc aggcctgtac tccctgacca       660
     gcaccctcta cctgaggctg cacaaggatg atcgggatgc caacttccac tgtgctgctc       720
     actacgactt gccctcaggc caacatggcc gcctggacag ccataccttt cgcctcaccc       780
     tgcactatcc cacggaacat gtagaattct gggtggggag cccgtccacc acggagggct       840
     gggtccgtga gggtgatgct gtccagctgc tctgccaggg cgatggcagc cccagcccag       900
     agtattcttt tttccgccag cagggtaccc aggaggaaca gctgaatgtc aacctcaagg       960
     gaaacttgac cctagaaggg gtgcatcgga accagagcgg gatctacggc tgcagagtgg      1020
     aggattacga tgccgacgag gaagtgcaac ttgtcaagaa gctaaagctg cacgtggcct      1080
     acctggatcc attggagctg agcgtgcctg aggagctctt cgtattcctg aacagcagca      1140
     gcacggtggt gaactgctcc gctagaggcc tgcctactcc tactgcgcga tggaccaagg      1200
     attctgtgac ccttgcagac ggccccatgc tctctctcca gtctgtgacc tttgactcag      1260
     ctggcaccta tacctgtgag gcgtccacac ccacagtccc cctcctgagc cgcacacaga      1320
     gtttccagct catcgtccaa ggagcaccag agttaaaacc gaatgagata atgcccaaat      1380
     cagggaatag ctggacagaa ggcgatgaag tcatgctgac ctgctccgcc cggggcttcc      1440
     cagagcccaa actcacctgg agtcagcgag gcgatactcc agcagagccg ccctttgagg      1500
     gtagaggctg gaagagcagc tcgctgatgg tgaaagtgac cagcgccctg agccgagagg      1560
     gcgtgtcctg tgaagcgtct aacatccatg gcaagaaagg ccatgtcttc cactttggct      1620
     ctgtggcccc tcagactgcc caggctggag tggctgtcat ggctgtagct gtcagcgtcg      1680
     gtcttttgct actcgtggtc gctgctttct attgcatgag acgcaaaggg cgccctggct      1740
     gctgccggcg agcagagaaa ggggcgccgc cagccaggga accggagttg agccactctg      1800
     ggtcagagcg gccagaacac acgggccttc tcatgggtgg gccctccgga ggaggcagag      1860
     gtggcagtgg aggctttgga gatgagtgtt gaggctgacg acctcccaga ggcaatctct      1920
     ggatctggaa ctttgggcat catcggagga ccggctctga gcacgcctcc gcctcagcgc      1980
     acgcctctgc ctccttcctt ctccagcctc ggccctccct tccttcctct gcctgctggg      2040
     cagggaccca caatggccag cggccttggg gagggaaaga gggaggtggg ggctgggagg      2100
     gggccttcct ccagggaatg taactttccc aggccccaga atagctcctg gatccaagcc      2160
     cggggcccgg cctgggacac ggcgctgagg gtcggcaggc tggggctatt tttacctcct      2220
     gactcccttg ctgggcacta cccccccacc tgataccctg ctgtgtagtc tgacactgga      2280
     gtccccaacc caccccattc ctgccctcat cctcagccca tcatttggaa cactggactt      2340
     tgaaataaat gctgcctgtc acgtggataa aaaaaaaaaa aaaaaaaaaa aaaaaaaaaa      2400
     aa                                                                     2402
//


spacer
spacer