Dbfetch

ID   AB033922; SV 1; linear; mRNA; STD; MUS; 2555 BP.
XX
AC   AB033922;
XX
DT   02-NOV-1999 (Rel. 61, Created)
DT   23-SEP-2008 (Rel. 97, Last updated, Version 3)
XX
DE   Mus musculus mRNA for Ndr1 related protein Ndr3, complete cds.
XX
KW   Ndr1 related protein Ndr3.
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi; Muroidea;
OC   Muridae; Murinae; Mus; Mus.
XX
RN   [1]
RP   1-2555
RA   Okuda T., Kondoh H.;
RT   ;
RL   Submitted (26-OCT-1999) to the INSDC.
RL   Tomohiko Okuda, Osaka University, Institute for Molecular and Cellular
RL   Biology; Yamada-oka, 1-3, Suita, Osaka 565-0871, Japan
RL   (E-mail:okuda@imcb.osaka-u.ac.jp, Tel:+61-6-6879-7964, Fax:+61-6-6877-1738)
XX
RN   [2]
RX   DOI; 10.1006/bbrc.1999.1780.
RX   PUBMED; 10581191.
RA   Okuda T., Kondoh H.;
RT   "Identification of new genes ndr2 and ndr3 which are related to
RT   Ndr1/RTP/Drg1 but show distinct tissue specificity and response to N-myc";
RL   Biochem. Biophys. Res. Commun. 266(1):208-215(1999).
XX
DR   MD5; e51b0fa5579ceb21aae14ccc8654a932.
DR   Ensembl-Gn; ENSMUSG00000027634; mus_musculus.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0026772; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_AJ_G0026738; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AKRJ_G0026709; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_BALBcJ_G0026747; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_C3HHeJ_G0026489; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0027196; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_CASTEiJ_G0025951; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CBAJ_G0026466; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_DBA2J_G0026604; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_FVBNJ_G0026571; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_LPJ_G0026709; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0026592; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0025685; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_WSBEiJ_G0026021; mus_musculus_wsbeij.
DR   Ensembl-Tr; ENSMUST00000072298; mus_musculus.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0058811; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_AJ_T0058832; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AKRJ_T0058777; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_BALBcJ_T0058766; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_C3HHeJ_T0058470; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0059244; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_CASTEiJ_T0058737; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CBAJ_T0058435; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_DBA2J_T0058539; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_FVBNJ_T0058522; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_LPJ_T0058670; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0058497; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0058302; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_WSBEiJ_T0057749; mus_musculus_wsbeij.
DR   EuropePMC; PMC1287101; 10831399.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..2555
FT                   /organism="Mus musculus"
FT                   /mol_type="mRNA"
FT                   /dev_stage="11.5 dpc"
FT                   /db_xref="taxon:10090"
FT   CDS             73..1200
FT                   /codon_start=1
FT                   /transl_table=1
FT                   /gene="Ndr3"
FT                   /product="Ndr1 related protein Ndr3"
FT                   /db_xref="GOA:Q9QYF9"
FT                   /db_xref="InterPro:IPR004142"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="InterPro:IPR030692"
FT                   /db_xref="MGI:MGI:1352499"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9QYF9"
FT                   /protein_id="BAA85883.1"
FT                   /translation="MDELQDVQLTEIKPLLNDKNGTRNFQDFDCQEHDIETPHGMVHVT
FT                   IRGLPKGNRPVILTYHDIGLNHKSCFNTFFNFEDMQEITQHFAVCHVDAPGQQEAAPSF
FT                   PTGYQYPTMDELAEMLPPVLTHLSMKSIIGIGVGAGAYILSRFALNHPELVEGLVLINI
FT                   DPCAKGWIDWAASKLSGFTTNIVDIILAHHFGQEELQANLDLIQTYRLHIAQDINQENL
FT                   QLFLGSYNGRRDLEIERPILGQNDNRLKTLKCSTLLVVGDNSPAVEAVVECNSRLDPIN
FT                   TTLLKMADCGGLPQVVQPGKLTEAFKYFLQGMGYIPSASMTRLARSRTHSTSSSIGSGE
FT                   SPFSRSVTSNQSDGTQESCESPDVLDRHQTMEVSC"
XX
SQ   Sequence 2555 BP; 667 A; 647 C; 592 G; 649 T; 0 other;
     attgacggcc ccgcgctagc gcttcagagt tcctggttca tccttgagac tcatctgctc        60
     tgagccatcc tcatggatga acttcaggat gttcaactca cagagatcaa accgcttcta       120
     aatgataaga atggcacacg aaacttccag gactttgact gtcaggaaca tgacattgaa       180
     acaccgcatg gtatggtcca cgtcaccata agaggcttac caaaaggaaa cagacctgtt       240
     atcctgacat accacgacat tgggctcaac cataagtcct gcttcaacac attcttcaac       300
     tttgaggata tgcaagagat cacccagcac tttgctgtct gtcacgtgga cgctcctggc       360
     caacaagaag cagcaccctc cttccccaca gggtaccagt accccaccat ggatgagcta       420
     gctgagatgc tgcctcctgt tctcacacac ttaagtatga agagcatcat tggtattggg       480
     gttggagcag gagcctacat tctcagcaga tttgcactga atcatccaga gctggtggaa       540
     ggtcttgtgc tcattaacat tgacccgtgt gctaagggct ggattgactg ggcagcttcc       600
     aaactctcag gttttaccac caacattgtg gacataattc tggctcatca ctttggccag       660
     gaggagttgc aggccaattt ggacctcatt caaacctaca gactgcacat tgctcaagat       720
     atcaaccaag aaaacctcca gctcttcctg ggttcctata atgggcgcag agacctggag       780
     atcgaaaggc ctatactggg ccaaaatgat aacagattga aaacgctaaa gtgttctacc       840
     ttactggtgg tgggggacaa ttcacctgct gtggaggctg tggttgaatg taattctcgc       900
     ctcgacccta taaatacaac tttgctaaag atggcagact gtggaggact gccccaagta       960
     gttcagcctg ggaagctcac cgaggccttc aagtactttt tgcagggaat gggctacata      1020
     ccatctgcca gcatgacccg gctcgcccga tcacgaaccc actccacctc aagtagcatt      1080
     ggctctggag aaagtccctt tagcaggtct gtgaccagca atcagtcaga tggaactcaa      1140
     gaatcctgtg agtcccctga tgtcctggac agacaccaga ccatggaagt gtcttgctaa      1200
     gcagatctcc tcccctggac catgcaagtc cctctccttg aaatgaccac tccgtaatag      1260
     aacatttcat tccgtcagct ggcccccact tcctttcact cacgcatggc cacagcatct      1320
     ctctctagta gccgagagtg tcattctctc caccctttct gtgtgtacca gagccacacc      1380
     catgccatta ctgtaacatt ccaacatctc catctgacct gacctccata tcttctcttg      1440
     ccagcctttc cctatgctcc ctcaaatatg tatctgatga gattctttaa ttcccaactc      1500
     catgtgtgtg cgagcacgcg tgtctgtgtc tgtgtgtgca tacttctgtg actttagaca      1560
     tgctttcttg tagtgcttct gcaaagggac tttttttgaa tcctcagtgg cattttttta      1620
     agggaaatat gcagagtgga tatctgggtg ggttgggcca caagattgga ttttggttcc      1680
     acttggacaa caaacagtat ttgcagagtg atttcaggag agagcaggtc tgaggaatat      1740
     gcaaaactgt agttactgtg tgggccattg actgccttga ccagtagaag ggataactat      1800
     tacacagata ggcaggcagg gtggcagtca cctcccctgt ccacgtggat ccatccctgc      1860
     cattgtgtga gtcagaggga tagatctgaa gcctgtgaat gatgtctggt acaccacagt      1920
     gttttctcca gagaactggc ctaagctcta gattagccaa gaaagctgga aaacagagcg      1980
     ccaggcttca ctctgcagag agaaagtgct ctgtccctgt agcgtctgat tccacttacc      2040
     agacacccac gcatctgcag gatgtctgat gcagagcggt tctccatccc tcagttccag      2100
     aaaaaatgga gtgatattta aaaatgccat cgatggtggg gatcttactg gggaagagga      2160
     aggaccatta gcacaccatc atgatgtcag atgacaaaat ggaagccaag acaccttgaa      2220
     ggtgactttc taggaaggtc ttaagcatgt aatgtccctt tatcagaggg aaggggacaa      2280
     actcagggca gccctgtcca ggtagaaata tttttgcccc cctgtctgat gttgatgagg      2340
     ggtcatacca gccagggaga ccctctggga ggaagctgcc acacacaagg actctggaag      2400
     tatccagatg tgagcccagc cagggtccta tggttccaaa tctgaagaaa aggtttttca      2460
     cacactcctt gctttctgct aagataagaa aggcgtcact ctgccagagt gtgacttttt      2520
     acagattaaa taaagctgta tatgtctcat tgtaa                                 2555
//