spacer

EBI Dbfetch

ID   AB033539; SV 1; linear; mRNA; STD; MUS; 657 BP.
XX
AC   AB033539;
XX
DT   14-APR-2005 (Rel. 83, Created)
DT   23-SEP-2008 (Rel. 97, Last updated, Version 2)
XX
DE   Mus musculus aprt mRNA for adenine phosphoribosyl transferase, complete
DE   cds.
XX
KW   .
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi; Muroidea;
OC   Muridae; Murinae; Mus; Mus.
XX
RN   [1]
RP   1-657
RA   Fujimori A.;
RT   ;
RL   Submitted (13-OCT-1999) to the INSDC.
RL   Akira Fujimori, Kyoto University, Dept. Radiation Genetics; Yoshida, Kyoto,
RL   606-8501, Japan (E-mail:fujimori@mfour.med.kyoto-u.ac.jp,
RL   Tel:81-75-753-4667)
XX
RN   [2]
RA   Fujimori A.;
RT   "mRNA aprt (wild-type allele) in murine SR-1 cell line";
RL   Unpublished.
XX
DR   MD5; 247917f6a694f347abeb36b1c2cc2f56.
DR   Ensembl-Gn; ENSMUSG00000006589; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000006764; mus_musculus.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..657
FT                   /organism="Mus musculus"
FT                   /mol_type="mRNA"
FT                   /cell_line="SR-1"
FT                   /tissue_type="epithelial carcinoma"
FT                   /db_xref="taxon:10090"
FT   CDS             59..601
FT                   /codon_start=1
FT                   /transl_table=1
FT                   /gene="aprt"
FT                   /product="adenine phosphoribosyl transferase"
FT                   /db_xref="GOA:P08030"
FT                   /db_xref="InterPro:IPR000836"
FT                   /db_xref="InterPro:IPR005764"
FT                   /db_xref="InterPro:IPR029057"
FT                   /db_xref="MGI:MGI:88061"
FT                   /db_xref="UniProtKB/Swiss-Prot:P08030"
FT                   /protein_id="BAD95571.1"
FT                   /translation="MSEPELKLVARRIRSFPDFPIPGVLFRDISPLLKDPDSFRASIRL
FT                   LASHLKSTHSGKIDYIAGLDSRGFLFGPSLAQELGVGCVLIRKQGKLPGPTVSASYSLE
FT                   YGKAELEIQKDALEPGQRVVIVDDLLATGGTMFAACDLLHQLRAEVVECVSLVELTSLK
FT                   GRERLGPIPFFSLLQYD"
XX
SQ   Sequence 657 BP; 122 A; 199 C; 194 G; 142 T; 0 other;
     gacgtgagtt tagcgtgctg atacctacct cctccctgcc tcctacacgc acgcggccat        60
     gtcggaacct gagttgaaac tggtggcgcg gcgcatccgc agcttccccg acttcccaat       120
     cccgggcgtg ctgttcaggg atatctcgcc cctcttgaaa gacccggact ccttccgagc       180
     ttccatccgc ctcttggcca gtcacctgaa gtccacgcac agcggcaaga tcgactacat       240
     cgcaggtcta gactccaggg gcttcctgtt tggcccttcc ctagctcagg agctgggcgt       300
     gggctgtgtg ctcatccgga aacaggggaa gctgccgggc cccactgtgt cagcctccta       360
     ttctctggag tatgggaagg ctgagctgga aatccagaaa gatgccttgg aacccgggca       420
     gagagtggtc attgtggatg acctcctggc cacaggagga accatgtttg cggcctgtga       480
     cctgctgcac cagctccggg ctgaagtggt ggagtgtgtg agcctggtgg agctgacctc       540
     gctgaagggc agggagaggc taggacctat accattcttc tctctcctcc agtatgactg       600
     aggagctggc tagatggtca cacccctgct cccagcagca ctaggaactg cttggtg          657
//


spacer
spacer